General information for g10087.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Peroxisomal membrane protein PMP34.
Parent gene
- The parent gene g10087 is located on chr_1: 7317247..7318822 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10087 | g10087.t1 | TTS | g10087.t1 | 7317069 | 7317069 |
| chr_1 | g10087 | g10087.t1 | isoform | g10087.t1 | 7317247 | 7318471 |
| chr_1 | g10087 | g10087.t1 | exon | g10087.t1.exon1 | 7317247 | 7317924 |
| chr_1 | g10087 | g10087.t1 | cds | g10087.t1.CDS1 | 7317247 | 7317924 |
| chr_1 | g10087 | g10087.t1 | exon | g10087.t1.exon2 | 7317990 | 7318090 |
| chr_1 | g10087 | g10087.t1 | cds | g10087.t1.CDS2 | 7317990 | 7318090 |
| chr_1 | g10087 | g10087.t1 | exon | g10087.t1.exon3 | 7318197 | 7318252 |
| chr_1 | g10087 | g10087.t1 | cds | g10087.t1.CDS3 | 7318197 | 7318252 |
| chr_1 | g10087 | g10087.t1 | exon | g10087.t1.exon4 | 7318392 | 7318471 |
| chr_1 | g10087 | g10087.t1 | cds | g10087.t1.CDS4 | 7318392 | 7318471 |
| chr_1 | g10087 | g10087.t1 | TSS | g10087.t1 | 7318538 | 7318538 |
Sequences
>g10087.t1 Gene=g10087 Length=915
ATGTCTAATTCAAAGGAAGCATTATCAAATTTGTTTTCATATCACCTTTTTGTTCATGCT
ACAAGTGGAAGTTGTGCCAGTCTCGTTGCAGTCGCAGCAGTTTATCCATTTCTAACAATT
CTACAAAGAAAGCAGTTGGATGACTTGAAAGCAGTTAGACATCTAAATTCATTTGAGCTA
ATTTATTATTTATTCAAAAAAGAAGGCTTAGGTTCAATTTATCGAGGACTGATTCCAGTA
ATGCAAAGTAGTTGCATCAGCAACTTTGTATATTTCTATGTTTTTCATTTATTGAAAAGC
TTCAAAACCAGAGATGCTCAATCAGCAGGGTCAGATTTAATACTCGGAACATTAGCTGGT
TGCATTAATGTATTAACCACCACTCCACTTTGGTGTGTAAATACAAGACTAAGAATGAAC
AATATTAACTACTCTCTCCCTTATGACAATCTCATATCTGGTCTCAAATATATTGCCAAG
AATGAGGGAATTGAAAAATTATGGGCTGGTACTCAAGCATCTCTATTACTCTCTATTAAC
CCTGCTATACAATTTTCAGTTTATGAGTCAATCAAGCGCTACTTGACAAAACTATATGGA
CAAGAAAAACCTTCTGTATTTTATTTTTTCTTTCTCGGAGCCTTATCTAAAGTCATTTCA
ACCTGCATAACTTATCCACTGCAATTAGTACAAACAAAAATGAGATATGGTGATAAAAAT
AACACAAATGAAATGGGTACTATGGAATTGCTTTTACAAATTATCAAAACCAATGGATTT
AAAGGATTATATGTTGGAATGGAAGCGAAATTTCTACAGACCATATTAACAGCTGCACTC
ATGTTTTTGGCTTATGAAAAGATTGCTCGATTTGTGAAAATTTTGTTGAGAGCATCAGCA
GCTTCGACAACTTAA
>g10087.t1 Gene=g10087 Length=304
MSNSKEALSNLFSYHLFVHATSGSCASLVAVAAVYPFLTILQRKQLDDLKAVRHLNSFEL
IYYLFKKEGLGSIYRGLIPVMQSSCISNFVYFYVFHLLKSFKTRDAQSAGSDLILGTLAG
CINVLTTTPLWCVNTRLRMNNINYSLPYDNLISGLKYIAKNEGIEKLWAGTQASLLLSIN
PAIQFSVYESIKRYLTKLYGQEKPSVFYFFFLGALSKVISTCITYPLQLVQTKMRYGDKN
NTNEMGTMELLLQIIKTNGFKGLYVGMEAKFLQTILTAALMFLAYEKIARFVKILLRASA
ASTT
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g10087.t1 | Gene3D | G3DSA:1.50.40.10 | Mitochondrial carrier domain | 16 | 301 | 7.5E-53 |
| 4 | g10087.t1 | PANTHER | PTHR45939:SF5 | PEROXISOMAL MEMBRANE PROTEIN PMP34 | 3 | 301 | 7.8E-96 |
| 5 | g10087.t1 | PANTHER | PTHR45939 | PEROXISOMAL MEMBRANE PROTEIN PMP34-RELATED | 3 | 301 | 7.8E-96 |
| 3 | g10087.t1 | Pfam | PF00153 | Mitochondrial carrier protein | 15 | 102 | 1.0E-10 |
| 2 | g10087.t1 | Pfam | PF00153 | Mitochondrial carrier protein | 108 | 197 | 1.1E-17 |
| 1 | g10087.t1 | Pfam | PF00153 | Mitochondrial carrier protein | 205 | 292 | 4.0E-17 |
| 20 | g10087.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 27 | g10087.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 38 | - |
| 19 | g10087.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 39 | 72 | - |
| 24 | g10087.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 73 | 93 | - |
| 22 | g10087.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 94 | 112 | - |
| 23 | g10087.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 113 | 133 | - |
| 17 | g10087.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 134 | 205 | - |
| 26 | g10087.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 206 | 227 | - |
| 21 | g10087.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 228 | 270 | - |
| 25 | g10087.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 271 | 288 | - |
| 18 | g10087.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 289 | 304 | - |
| 16 | g10087.t1 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. | 1 | 25 | 5.0 |
| 13 | g10087.t1 | ProSiteProfiles | PS50920 | Solute carrier (Solcar) repeat profile. | 14 | 101 | 15.348 |
| 14 | g10087.t1 | ProSiteProfiles | PS50920 | Solute carrier (Solcar) repeat profile. | 107 | 194 | 17.836 |
| 15 | g10087.t1 | ProSiteProfiles | PS50920 | Solute carrier (Solcar) repeat profile. | 204 | 291 | 18.201 |
| 11 | g10087.t1 | SUPERFAMILY | SSF103506 | Mitochondrial carrier | 15 | 287 | 3.53E-56 |
| 9 | g10087.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 37 | - |
| 8 | g10087.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 98 | - |
| 7 | g10087.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 113 | 135 | - |
| 6 | g10087.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 206 | 228 | - |
| 10 | g10087.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 263 | 285 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K13354 (solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
