General information for g10125.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g10125 is located on chr_1: 7636113..7636738 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10125 | g10125.t1 | TTS | g10125.t1 | 7636021 | 7636021 |
| chr_1 | g10125 | g10125.t1 | isoform | g10125.t1 | 7636113 | 7636738 |
| chr_1 | g10125 | g10125.t1 | exon | g10125.t1.exon1 | 7636113 | 7636324 |
| chr_1 | g10125 | g10125.t1 | cds | g10125.t1.CDS1 | 7636113 | 7636324 |
| chr_1 | g10125 | g10125.t1 | exon | g10125.t1.exon2 | 7636585 | 7636663 |
| chr_1 | g10125 | g10125.t1 | cds | g10125.t1.CDS2 | 7636585 | 7636663 |
| chr_1 | g10125 | g10125.t1 | exon | g10125.t1.exon3 | 7636736 | 7636738 |
| chr_1 | g10125 | g10125.t1 | cds | g10125.t1.CDS3 | 7636736 | 7636738 |
| chr_1 | g10125 | g10125.t1 | TSS | g10125.t1 | 7636825 | 7636825 |
Sequences
>g10125.t1 Gene=g10125 Length=294
ATGTCTCAAGAAGTAGAAGAAACTTTGAAAAGAATCCAGCAGCATAAAGGAGTAGTTGGT
ACTATTGTAGTCAATAATGAAGGAGTTGCAGTAAAGAGCACGCTAGACAACACTTCAACA
GTGCAATATGCTGGTTTAATGGGTCAATTGGCAGATAAAGCACGCAGTGTTGTACGAGAT
TTGGATCCATCAAATGATCTTACATTCCTTAGAATTCGTTCAAAAAAGCATGAGATCATG
ATTGCACCTGATAAAGATTTTATCATGATTGTCATTCAAAATCCAACCGATTAA
>g10125.t1 Gene=g10125 Length=97
MSQEVEETLKRIQQHKGVVGTIVVNNEGVAVKSTLDNTSTVQYAGLMGQLADKARSVVRD
LDPSNDLTFLRIRSKKHEIMIAPDKDFIMIVIQNPTD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g10125.t1 | Gene3D | G3DSA:3.30.450.30 | Dynein light chain 2a | 1 | 97 | 0 |
| 2 | g10125.t1 | PANTHER | PTHR10779:SF17 | DYNEIN LIGHT CHAIN ROADBLOCK-TYPE 1 | 4 | 97 | 0 |
| 3 | g10125.t1 | PANTHER | PTHR10779 | DYNEIN LIGHT CHAIN ROADBLOCK | 4 | 97 | 0 |
| 7 | g10125.t1 | PIRSF | PIRSF009998 | DLC7 | 1 | 97 | 0 |
| 1 | g10125.t1 | Pfam | PF03259 | Roadblock/LC7 domain | 5 | 94 | 0 |
| 5 | g10125.t1 | SMART | SM00960 | Robl_LC7_a_2 | 5 | 93 | 0 |
| 4 | g10125.t1 | SUPERFAMILY | SSF103196 | Roadblock/LC7 domain | 3 | 96 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007018 | microtubule-based movement | BP |
| GO:0005868 | cytoplasmic dynein complex | CC |
KEGG
Orthology
- This transcript has been annotated with K10419 (dynein light chain roadblock-type)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
