General information for g10214.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Translocating chain-associated membrane protein 1-like 1.
Parent gene
- The parent gene g10214 is located on chr_1: 8264765..8265878 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10214 | g10214.t1 | TSS | g10214.t1 | 8263065 | 8263065 |
| chr_1 | g10214 | g10214.t1 | isoform | g10214.t1 | 8263386 | 8265106 |
| chr_1 | g10214 | g10214.t1 | exon | g10214.t1.exon1 | 8263386 | 8263532 |
| chr_1 | g10214 | g10214.t1 | cds | g10214.t1.CDS1 | 8263386 | 8263532 |
| chr_1 | g10214 | g10214.t1 | exon | g10214.t1.exon2 | 8263947 | 8264020 |
| chr_1 | g10214 | g10214.t1 | cds | g10214.t1.CDS2 | 8263947 | 8264020 |
| chr_1 | g10214 | g10214.t1 | exon | g10214.t1.exon3 | 8264092 | 8264200 |
| chr_1 | g10214 | g10214.t1 | cds | g10214.t1.CDS3 | 8264092 | 8264200 |
| chr_1 | g10214 | g10214.t1 | exon | g10214.t1.exon4 | 8264259 | 8264700 |
| chr_1 | g10214 | g10214.t1 | cds | g10214.t1.CDS4 | 8264259 | 8264700 |
| chr_1 | g10214 | g10214.t1 | exon | g10214.t1.exon5 | 8264757 | 8265106 |
| chr_1 | g10214 | g10214.t1 | cds | g10214.t1.CDS5 | 8264757 | 8265106 |
| chr_1 | g10214 | g10214.t1 | TTS | g10214.t1 | 8265855 | 8265855 |
Sequences
>g10214.t1 Gene=g10214 Length=1122
ATGTCATCAGCGTTAAGAACGAAACCATTTGGAGGCAAAAAAGATAAGAAGAATCCACCG
ATTCTAAGTCATGAATTTGTTATTCAGAATCATGCAGATATCGTCTCATGTGTTGCAATG
GTGTTTGTCGTCGGTCTAATGATGCAAGCAACAAGTACATTAGCTAGCATTTTTATTGTA
ATGGGTCACAATGTGACTGATCCAACGGATGCTGCTACAAGAAACGAGCCTTTCTTATAT
GAATCTGGTTGGAGAGATGGACCTGCTGTTTTCTTTTATACTCTTATCTGTATAATCATG
CATGCAATTTTGCAAGAATATGTTTTAGATAAAGTTTCCAAGAAACTTCATCTCTCAAAG
TTCAAACTTTCACGATTCAATGAGTCTGGTCAACTTGTTGTCTTTTACTTAATGTCGTTC
CTTTGGGGTGCTGAAATCATCATTCGTGAGCAATATGCTGAAAATATGTCAAAACTTTGG
GTAGATTTCCCAAATCATCCAATGACATTCTTGCACAAGCTCTACTTCATCATTCAGCTT
GCTTACTACTTACATATGTTGCCAGAACTTTATTTCCAAAAGATTAAGAAAGATGAACAG
CTACCAAAGATTCAACATTCTATTGCAGGGACACTTATTATTGGCTTCTTCTATTTCTTC
GCTTATCGTCGTATTGCCATTGTTTTGTTGACTCTTCATTATTTCAGCGAATTTGTTGCA
CATACATTTGGACTTCTTGAAGTCTTTGACAAGGAAGAGAAATATGCTAAATTCCGCGTT
TTCAACAACATCATTTTCCTCCTTACCGCCTTCTCGACCTTGGTTCTTTCATTCCTCACT
TTCTTCACTGGAATAGGAAAATCAAATCCAACAAGTGGCATGACTGGTTTACTCATTGCC
TTTTCTATTCAAGGCTTTCTCATTTTCCGATTTATTACAAGTTTCCTCAAATCAAAACGT
GAATCAAAGGAGCAGCAAGCCCTTAAACAGCCATTGACAAAGAAATCAAAGGCTAGTGGT
GAAACAAAGAATGCTGCTTCAAGTAAAAAAGACCGCAAGAAGGAATCAGATTTGCCAGAA
GCAGATCAAAATGTAAGCCAAAAGAAAGTCAAGACCAAGTAA
>g10214.t1 Gene=g10214 Length=373
MSSALRTKPFGGKKDKKNPPILSHEFVIQNHADIVSCVAMVFVVGLMMQATSTLASIFIV
MGHNVTDPTDAATRNEPFLYESGWRDGPAVFFYTLICIIMHAILQEYVLDKVSKKLHLSK
FKLSRFNESGQLVVFYLMSFLWGAEIIIREQYAENMSKLWVDFPNHPMTFLHKLYFIIQL
AYYLHMLPELYFQKIKKDEQLPKIQHSIAGTLIIGFFYFFAYRRIAIVLLTLHYFSEFVA
HTFGLLEVFDKEEKYAKFRVFNNIIFLLTAFSTLVLSFLTFFTGIGKSNPTSGMTGLLIA
FSIQGFLIFRFITSFLKSKRESKEQQALKQPLTKKSKASGETKNAASSKKDRKKESDLPE
ADQNVSQKKVKTK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 14 | g10214.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 324 | 373 | - |
| 15 | g10214.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 344 | 373 | - |
| 3 | g10214.t1 | PANTHER | PTHR12371:SF11 | TRANSLOCATING CHAIN-ASSOCIATED MEMBRANE PROTEIN | 14 | 369 | 1.7E-126 |
| 4 | g10214.t1 | PANTHER | PTHR12371 | TRANSLOCATION ASSOCIATED MEMBRANE PROTEIN | 14 | 369 | 1.7E-126 |
| 1 | g10214.t1 | Pfam | PF08390 | TRAM1-like protein | 56 | 121 | 1.6E-17 |
| 2 | g10214.t1 | Pfam | PF03798 | TLC domain | 125 | 271 | 2.7E-15 |
| 19 | g10214.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 33 | - |
| 26 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 34 | 60 | - |
| 25 | g10214.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 61 | 89 | - |
| 30 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 90 | 109 | - |
| 17 | g10214.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 110 | 129 | - |
| 28 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 130 | 148 | - |
| 24 | g10214.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 149 | 173 | - |
| 32 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 174 | 192 | - |
| 21 | g10214.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 193 | 203 | - |
| 27 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 204 | 221 | - |
| 23 | g10214.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 222 | 226 | - |
| 31 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 227 | 248 | - |
| 18 | g10214.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 249 | 259 | - |
| 33 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 260 | 282 | - |
| 22 | g10214.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 283 | 293 | - |
| 29 | g10214.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 294 | 313 | - |
| 20 | g10214.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 314 | 373 | - |
| 16 | g10214.t1 | ProSiteProfiles | PS50922 | TLC domain profile. | 124 | 323 | 9.761 |
| 13 | g10214.t1 | SMART | SM00724 | lag1_27 | 124 | 320 | 2.1E-22 |
| 11 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 38 | 60 | - |
| 5 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 87 | 109 | - |
| 8 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 130 | 149 | - |
| 10 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 169 | 191 | - |
| 6 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 204 | 221 | - |
| 9 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 225 | 247 | - |
| 12 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 260 | 282 | - |
| 7 | g10214.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 292 | 314 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006616 | SRP-dependent cotranslational protein targeting to membrane, translocation | BP |
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K14010 (translocating chain-associated membrane protein 1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
