General information for g10221.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Fatty acid-binding protein 5.
Parent gene
- The parent gene g10221 is located on chr_1: 8341426..8341897 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10221 | g10221.t3 | TSS | g10221.t3 | 8339382 | 8339382 |
| chr_1 | g10221 | g10221.t3 | isoform | g10221.t3 | 8339384 | 8341564 |
| chr_1 | g10221 | g10221.t3 | exon | g10221.t3.exon1 | 8339384 | 8339408 |
| chr_1 | g10221 | g10221.t3 | exon | g10221.t3.exon2 | 8341180 | 8341347 |
| chr_1 | g10221 | g10221.t3 | cds | g10221.t3.CDS1 | 8341188 | 8341347 |
| chr_1 | g10221 | g10221.t3 | exon | g10221.t3.exon3 | 8341410 | 8341564 |
| chr_1 | g10221 | g10221.t3 | cds | g10221.t3.CDS2 | 8341410 | 8341564 |
| chr_1 | g10221 | g10221.t3 | TTS | g10221.t3 | 8341894 | 8341894 |
Sequences
>g10221.t3 Gene=g10221 Length=348
TTCACGTTTCATTCATCGCTCATTTGTGTTGGAATGGTTCTTCGTAAGATGGGAATGTCT
GTTCATCCTACAGTTTACCTTGTCAAGGATGGTGATGAATACAGTTTCCATACTGACTCA
ACTTTCAAAAATACCGTCATGAAATTCAAGCTCGGAGAAGAATTTGAAAATGAAACATTG
GATGGACGTAAAGTACAAACTGTTATCACTCTCGATGGTAACACAATGACTCAGGTTGAG
AAAGGTGAAAAGAAATCGGTGATTGTTCGTGAATTCAGCGACAGTGAGGTCGTAGTCACA
TGTGAATATGATGGCGTAGTGAGCAAACGCTGGTACAAAGTTGTTTAA
>g10221.t3 Gene=g10221 Length=104
MVLRKMGMSVHPTVYLVKDGDEYSFHTDSTFKNTVMKFKLGEEFENETLDGRKVQTVITL
DGNTMTQVEKGEKKSVIVREFSDSEVVVTCEYDGVVSKRWYKVV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g10221.t3 | Gene3D | G3DSA:2.40.128.20 | - | 1 | 104 | 0 |
| 2 | g10221.t3 | PANTHER | PTHR11955 | FATTY ACID BINDING PROTEIN | 1 | 102 | 0 |
| 4 | g10221.t3 | PRINTS | PR00178 | Fatty acid-binding protein signature | 37 | 53 | 0 |
| 3 | g10221.t3 | PRINTS | PR00178 | Fatty acid-binding protein signature | 83 | 103 | 0 |
| 1 | g10221.t3 | Pfam | PF00061 | Lipocalin / cytosolic fatty-acid binding protein family | 12 | 97 | 0 |
| 5 | g10221.t3 | SUPERFAMILY | SSF50814 | Lipocalins | 2 | 102 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0008289 | lipid binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
