General information for g10375.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Zinc transporter ZIP9.
Parent gene
- The parent gene g10375 is located on chr_1: 9321575..9322403 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10375 | g10375.t1 | TTS | g10375.t1 | 9320462 | 9320462 |
| chr_1 | g10375 | g10375.t1 | isoform | g10375.t1 | 9320594 | 9321575 |
| chr_1 | g10375 | g10375.t1 | exon | g10375.t1.exon1 | 9320594 | 9321406 |
| chr_1 | g10375 | g10375.t1 | cds | g10375.t1.CDS1 | 9320594 | 9321406 |
| chr_1 | g10375 | g10375.t1 | exon | g10375.t1.exon2 | 9321480 | 9321575 |
| chr_1 | g10375 | g10375.t1 | cds | g10375.t1.CDS2 | 9321480 | 9321575 |
| chr_1 | g10375 | g10375.t1 | TSS | g10375.t1 | 9321801 | 9321801 |
Sequences
>g10375.t1 Gene=g10375 Length=909
ATGGATGACACAGTTGTTTTAATTCTACTCGTTATTGTGATGCTTGTAGGCTCCTACTTA
GCTGGAAGCATTCCATTAGTTGTTAATTTATCAGAGGCCAAACTTAAGATGGTATCAATA
CTTGGTGCGGGACTATTAGTTGGTACAGCTTTAATTGTAATCATTCCCGAGGGTGTTAGA
TCACTTTATGCTAATGAAAAAAGTGGAGAGCATAGTGAAACTGCGACTGAACAGAATCAT
CATCATGAAGAACCGGAAGATTTTTCTAAAACAATTGGATTATCATTGGTGCTAGGTTTT
GTTTTCATGATGCTTGTTGAGCAGATATCTTCACGTCGAACACATAGTCCAGATGGAAAA
GAAATTAAAAGGAATCCTACAGCCACAATTGGCTTAGTAGTGCATGCAGCTGCTGATGGA
ATCGCATTAGGAGCGGCTGCTAAAACAAGCCATCAAGATGTAGAAATGATTGTTTTTCTT
GCAATCATGTTACACAAAGCACCAGCTGCATTTGGTTTAGTTAGTTTTCTTCTACATGAA
GGCATAGATCGGCAACGAATAAGAAAACATCTAGGAATATTTTCTCTATCTGCTCCTTTA
CTTACATTAGTTACCTATTTTGGAATTGCTCAAGAGCAAAAAGAGACATTGAATTCAGTA
AATGCAACTGCCGTTGCTATGCTATTTTCAGCTGGAACTTTTCTGTACGTCGCAACTGTA
CACGTATTACCCGAATTGACAAATCAACAACCACATTTTCATCATGCCTCTTCTGGTCCT
CATTATAGTCATCTTGAGCAAGGAACTACAAGTTCAAAGCCACAAAGTGGACTTACCAAT
ATTGAATTATTAACACTTATTTCTGGGGCATTGTTACCACTTTTTCTTACATTAGGACAT
CATCATTAG
>g10375.t1 Gene=g10375 Length=302
MDDTVVLILLVIVMLVGSYLAGSIPLVVNLSEAKLKMVSILGAGLLVGTALIVIIPEGVR
SLYANEKSGEHSETATEQNHHHEEPEDFSKTIGLSLVLGFVFMMLVEQISSRRTHSPDGK
EIKRNPTATIGLVVHAAADGIALGAAAKTSHQDVEMIVFLAIMLHKAPAAFGLVSFLLHE
GIDRQRIRKHLGIFSLSAPLLTLVTYFGIAQEQKETLNSVNATAVAMLFSAGTFLYVATV
HVLPELTNQQPHFHHASSGPHYSHLEQGTTSSKPQSGLTNIELLTLISGALLPLFLTLGH
HH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g10375.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 66 | 88 | - |
| 3 | g10375.t1 | PANTHER | PTHR16133 | SOLUTE CARRIER FAMILY 39 ZINC TRANSPORTER , MEMBER 9-RELATED | 1 | 302 | 2.8E-105 |
| 2 | g10375.t1 | Pfam | PF02535 | ZIP Zinc transporter | 6 | 116 | 5.2E-14 |
| 1 | g10375.t1 | Pfam | PF02535 | ZIP Zinc transporter | 127 | 296 | 2.2E-26 |
| 19 | g10375.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 5 | - |
| 21 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 6 | 28 | - |
| 12 | g10375.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 29 | 34 | - |
| 25 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 55 | - |
| 20 | g10375.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 56 | 87 | - |
| 22 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 88 | 106 | - |
| 15 | g10375.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 107 | 126 | - |
| 27 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 127 | 145 | - |
| 16 | g10375.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 146 | 156 | - |
| 28 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 179 | - |
| 14 | g10375.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 180 | 190 | - |
| 24 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 210 | - |
| 18 | g10375.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 211 | 221 | - |
| 26 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 222 | 243 | - |
| 13 | g10375.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 244 | 280 | - |
| 23 | g10375.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 281 | 299 | - |
| 17 | g10375.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 300 | 302 | - |
| 10 | g10375.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 5 | 27 | - |
| 8 | g10375.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 37 | 59 | - |
| 4 | g10375.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 130 | 147 | - |
| 5 | g10375.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 179 | - |
| 9 | g10375.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 210 | - |
| 7 | g10375.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 220 | 242 | - |
| 6 | g10375.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 277 | 299 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0055085 | transmembrane transport | BP |
| GO:0046873 | metal ion transmembrane transporter activity | MF |
| GO:0030001 | metal ion transport | BP |
KEGG
Orthology
- This transcript has been annotated with K14715 (solute carrier family 39 (zinc transporter), member 9)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
