General information for g10620.t15
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Peptidyl-prolyl cis-trans isomerase.
Parent gene
- The parent gene g10620 is located on chr_1: 10784687..10791620 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10620 | g10620.t15 | TSS | g10620.t15 | 10782911 | 10782911 |
| chr_1 | g10620 | g10620.t15 | isoform | g10620.t15 | 10783321 | 10784929 |
| chr_1 | g10620 | g10620.t15 | exon | g10620.t15.exon1 | 10783321 | 10783471 |
| chr_1 | g10620 | g10620.t15 | exon | g10620.t15.exon2 | 10784379 | 10784491 |
| chr_1 | g10620 | g10620.t15 | cds | g10620.t15.CDS1 | 10784446 | 10784491 |
| chr_1 | g10620 | g10620.t15 | exon | g10620.t15.exon3 | 10784539 | 10784619 |
| chr_1 | g10620 | g10620.t15 | cds | g10620.t15.CDS2 | 10784539 | 10784619 |
| chr_1 | g10620 | g10620.t15 | exon | g10620.t15.exon4 | 10784684 | 10784747 |
| chr_1 | g10620 | g10620.t15 | cds | g10620.t15.CDS3 | 10784684 | 10784747 |
| chr_1 | g10620 | g10620.t15 | exon | g10620.t15.exon5 | 10784809 | 10784929 |
| chr_1 | g10620 | g10620.t15 | cds | g10620.t15.CDS4 | 10784809 | 10784929 |
| chr_1 | g10620 | g10620.t15 | TTS | g10620.t15 | 10785316 | 10785316 |
Sequences
>g10620.t15 Gene=g10620 Length=530
AGTTCAGTTTAAGAGTTTGACGAGAACGCACGCAGCATTTTCTACAGTCAGCTTACAATT
AATTCGTAATTTTGCAAGCAAAATGGGATTTCCTCGAGTTTTTTTCGATATGGCCGCTGA
TGGTCAAGCACTTGGAAGAATTGTAATTGAACTTCGTACTGATGTCGTCCCAAAAACATG
CGAAAACTTCCGTGCGTTGTGCACCGGCGAAAAGGGATATGGATATAAAGGTTCAACATT
CCACCGTGTCATTCCCAATTTCATCAATCTATGGCAACAAGTTTGAGGATGAGAACTTCA
CATTGAAGCACACTGGCCCTGGCATTATGTCAATGGCTAATGCAGGACCAAACACTAATG
GTTCTCAGTTCTTCATTACGACTGTGAAAACTAGCTGGTTAGACAACAGACACGTAGTTT
TCGGATCAGTTGTCGAAGGCATGGATATTGTCAAGAAGATTGAGTCATATGGATCTCAAT
CAGGCAAGCCATCAAAGAACATCACTATTGCCAACTCTGGTCAACTCTAA
>g10620.t15 Gene=g10620 Length=103
MDIKVQHSTVSFPISSIYGNKFEDENFTLKHTGPGIMSMANAGPNTNGSQFFITTVKTSW
LDNRHVVFGSVVEGMDIVKKIESYGSQSGKPSKNITIANSGQL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g10620.t15 | Gene3D | G3DSA:2.40.100.10 | - | 5 | 103 | 0.000 |
| 2 | g10620.t15 | PANTHER | PTHR11071:SF503 | PEPTIDYLPROLYL ISOMERASE E (CYCLOPHILIN E) | 16 | 102 | 0.000 |
| 3 | g10620.t15 | PANTHER | PTHR11071 | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE | 16 | 102 | 0.000 |
| 4 | g10620.t15 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 35 | 50 | 0.000 |
| 6 | g10620.t15 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 50 | 62 | 0.000 |
| 5 | g10620.t15 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 63 | 78 | 0.000 |
| 1 | g10620.t15 | Pfam | PF00160 | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | 20 | 100 | 0.000 |
| 9 | g10620.t15 | ProSiteProfiles | PS50072 | Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain profile. | 1 | 102 | 24.085 |
| 7 | g10620.t15 | SUPERFAMILY | SSF50891 | Cyclophilin-like | 16 | 103 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003755 | peptidyl-prolyl cis-trans isomerase activity | MF |
| GO:0000413 | protein peptidyl-prolyl isomerization | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
