General information for g10620.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Peptidyl-prolyl cis-trans isomerase.
Parent gene
- The parent gene g10620 is located on chr_1: 10784687..10791620 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10620 | g10620.t3 | isoform | g10620.t3 | 10781885 | 10784929 |
| chr_1 | g10620 | g10620.t3 | exon | g10620.t3.exon1 | 10781885 | 10781890 |
| chr_1 | g10620 | g10620.t3 | exon | g10620.t3.exon2 | 10783356 | 10783471 |
| chr_1 | g10620 | g10620.t3 | cds | g10620.t3.CDS1 | 10783403 | 10783471 |
| chr_1 | g10620 | g10620.t3 | exon | g10620.t3.exon3 | 10784379 | 10784619 |
| chr_1 | g10620 | g10620.t3 | cds | g10620.t3.CDS2 | 10784379 | 10784619 |
| chr_1 | g10620 | g10620.t3 | exon | g10620.t3.exon4 | 10784684 | 10784747 |
| chr_1 | g10620 | g10620.t3 | cds | g10620.t3.CDS3 | 10784684 | 10784747 |
| chr_1 | g10620 | g10620.t3 | exon | g10620.t3.exon5 | 10784809 | 10784929 |
| chr_1 | g10620 | g10620.t3 | cds | g10620.t3.CDS4 | 10784809 | 10784929 |
| chr_1 | g10620 | g10620.t3 | TTS | g10620.t3 | 10785316 | 10785316 |
| chr_1 | g10620 | g10620.t3 | TSS | g10620.t3 | NA | NA |
Sequences
>g10620.t3 Gene=g10620 Length=548
TATTTACATTTTCTACAGTCAGCTTACAATTAATTCGTAATTTTGCAAGCAAAATGGGAT
TTCCTCGAGTTTTTTTCGATATGGCCGCTGATGGTCAAGCACTTGGAAGAATTGTAATTG
AACTTCGTACTGATGTCGTCCCAAAAACATGCGAAAACTTCCGTGCGTTGTGCACCGGCG
AAAAGGGATATGGATATAAAGGTTCAACATTCCACCGTGTCATTCCCAATTTCATGTGTC
AAGGCGGTGACTTTACAAATCACAATGGAACTGGAGGAAAATCAATCTATGGCAACAAGT
TTGAGGATGAGAACTTCACATTGAAGCACACTGGCCCTGGCATTATGTCAATGGCTAATG
CAGGACCAAACACTAATGGTTCTCAGTTCTTCATTACGACTGTGAAAACTAGCTGGTTAG
ACAACAGACACGTAGTTTTCGGATCAGTTGTCGAAGGCATGGATATTGTCAAGAAGATTG
AGTCATATGGATCTCAATCAGGCAAGCCATCAAAGAACATCACTATTGCCAACTCTGGTC
AACTCTAA
>g10620.t3 Gene=g10620 Length=164
MGFPRVFFDMAADGQALGRIVIELRTDVVPKTCENFRALCTGEKGYGYKGSTFHRVIPNF
MCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGIMSMANAGPNTNGSQFFITTVKTS
WLDNRHVVFGSVVEGMDIVKKIESYGSQSGKPSKNITIANSGQL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g10620.t3 | CDD | cd01926 | cyclophilin_ABH_like | 4 | 162 | 7.18222E-115 |
| 10 | g10620.t3 | Gene3D | G3DSA:2.40.100.10 | - | 2 | 164 | 1.5E-83 |
| 2 | g10620.t3 | PANTHER | PTHR11071 | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE | 4 | 164 | 1.2E-90 |
| 3 | g10620.t3 | PANTHER | PTHR11071:SF408 | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE F, MITOCHONDRIAL | 4 | 164 | 1.2E-90 |
| 11 | g10620.t3 | PIRSF | PIRSF001467 | Peptidylpro_ismrse | 1 | 164 | 7.3E-81 |
| 8 | g10620.t3 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 24 | 39 | 6.2E-40 |
| 7 | g10620.t3 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 53 | 65 | 6.2E-40 |
| 5 | g10620.t3 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 96 | 111 | 6.2E-40 |
| 4 | g10620.t3 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 111 | 123 | 6.2E-40 |
| 6 | g10620.t3 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 124 | 139 | 6.2E-40 |
| 1 | g10620.t3 | Pfam | PF00160 | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | 9 | 161 | 6.9E-51 |
| 13 | g10620.t3 | ProSitePatterns | PS00170 | Cyclophilin-type peptidyl-prolyl cis-trans isomerase signature. | 48 | 65 | - |
| 14 | g10620.t3 | ProSiteProfiles | PS50072 | Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain profile. | 7 | 163 | 45.853 |
| 9 | g10620.t3 | SUPERFAMILY | SSF50891 | Cyclophilin-like | 3 | 164 | 5.41E-77 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006457 | protein folding | BP |
| GO:0003755 | peptidyl-prolyl cis-trans isomerase activity | MF |
| GO:0000413 | protein peptidyl-prolyl isomerization | BP |
KEGG
Orthology
- This transcript has been annotated with K09565 (peptidyl-prolyl isomerase F (cyclophilin D))
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
