General information for g10639.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Acyl-CoA Delta(11) desaturase.
Parent gene
- The parent gene g10639 is located on chr_1: 10995780..10996847 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10639 | g10639.t1 | isoform | g10639.t1 | 10994355 | 10996520 |
| chr_1 | g10639 | g10639.t1 | exon | g10639.t1.exon1 | 10994355 | 10994487 |
| chr_1 | g10639 | g10639.t1 | cds | g10639.t1.CDS1 | 10994355 | 10994487 |
| chr_1 | g10639 | g10639.t1 | exon | g10639.t1.exon2 | 10994864 | 10995332 |
| chr_1 | g10639 | g10639.t1 | cds | g10639.t1.CDS2 | 10994864 | 10995332 |
| chr_1 | g10639 | g10639.t1 | exon | g10639.t1.exon3 | 10995782 | 10996014 |
| chr_1 | g10639 | g10639.t1 | cds | g10639.t1.CDS3 | 10995782 | 10996014 |
| chr_1 | g10639 | g10639.t1 | exon | g10639.t1.exon4 | 10996076 | 10996360 |
| chr_1 | g10639 | g10639.t1 | cds | g10639.t1.CDS4 | 10996076 | 10996360 |
| chr_1 | g10639 | g10639.t1 | exon | g10639.t1.exon5 | 10996450 | 10996520 |
| chr_1 | g10639 | g10639.t1 | cds | g10639.t1.CDS5 | 10996450 | 10996520 |
| chr_1 | g10639 | g10639.t1 | TTS | g10639.t1 | 10996840 | 10996840 |
| chr_1 | g10639 | g10639.t1 | TSS | g10639.t1 | NA | NA |
Sequences
>g10639.t1 Gene=g10639 Length=1191
ATGGATTCAAATTTGCATGAATCAATATGCCATCCCGAGGGTAAACAAAATGGATATGTA
AATGGGAATATTGTTGCCAATAGCAATTATAGCAATGGAATTAAAAATGGAGAAATCAAG
AATGGTCATGCAGGAACATCTACAGAGCAAAAACAAGAATACAAAATGCAAATAAAGTGG
CTGAATGTGCTACTCTTTGCTTATTTACATGGAGCAGCTTTATATGGAATGATAATGCCA
TGGAAATGGTCATCATTTGCAGTTTGTTTTGTCTATACAGCTTTAGCGGGTTTTGGAACA
ACTGTTGCTGCACATCGATATTTTACACATCGAAGTTTCAAGGCTAACAAGAAATTGAGA
TGGATTCTTATAATTTTACAAACAACATGTGCTCAGGAACCAATTTTAAATTGGGCTCGT
GATCATCGTGTTCATCATAAATTTACAGACACTGATGCTGATCCATATAATTCAAGGCGA
GGTTTCTTTTTCTCACATATTGGTTGGTTGATGGTTAAAAAACATCCTGAAGTTATCAGA
CAAGGAAAGAAAATTGATATGAGTGACCTTGAGAGTGATCCTATGCTTCAATTCCAAAGA
AGGTGGTATCATTTGCTTGCTTTCCTTTTAAACCTTGGCATTCCGATTGTTTTTTTGACA
TACATGGGCGAGCCATTTTCAGTCATTTGGCACGGAAATATTTTCCGTTGGGTTATTCAA
CTCAATCTTGTATGGTGTGTTAACTCCGTGGCTCATCTCTATGGCACAAAGCCTTATGAC
AAAGACATTTCACCGACTGATTCACGTCTAGTTGGATTTTTAGCTATGGGAGAAGGCTGG
CATAATTATCACCATGTGTTTCCTTGGGACTACAAGACAGCAGAACTTCCAGGATACGGT
TGGAACTTGTCAACTGCTGTCATTGATTTCTTCGCATGGTTAGGCTGGGCTACAGAATTG
AAAACTGTTCCTGATGCAATAATTAAAAAGCGCGTACTAAGAACTGGTGATGGCAGTCAT
CCATATTCAATTGCGGCAGTTGAAGAGAATAATAATAATCTTAGCGATGAGATCGACGCA
CAAACGCAAATAAGAGATACTGAGCATTTTTGGGGCTTTGGTGACAAAGAAATGACATCA
GAAGATATGAAATATGTACACATCATTAATCCAGAGAAGAAAATTTCTTAA
>g10639.t1 Gene=g10639 Length=396
MDSNLHESICHPEGKQNGYVNGNIVANSNYSNGIKNGEIKNGHAGTSTEQKQEYKMQIKW
LNVLLFAYLHGAALYGMIMPWKWSSFAVCFVYTALAGFGTTVAAHRYFTHRSFKANKKLR
WILIILQTTCAQEPILNWARDHRVHHKFTDTDADPYNSRRGFFFSHIGWLMVKKHPEVIR
QGKKIDMSDLESDPMLQFQRRWYHLLAFLLNLGIPIVFLTYMGEPFSVIWHGNIFRWVIQ
LNLVWCVNSVAHLYGTKPYDKDISPTDSRLVGFLAMGEGWHNYHHVFPWDYKTAELPGYG
WNLSTAVIDFFAWLGWATELKTVPDAIIKKRVLRTGDGSHPYSIAAVEENNNNLSDEIDA
QTQIRDTEHFWGFGDKEMTSEDMKYVHIINPEKKIS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 23 | g10639.t1 | CDD | cd03505 | Delta9-FADS-like | 82 | 321 | 3.91295E-69 |
| 13 | g10639.t1 | Coils | Coil | Coil | 344 | 364 | - |
| 2 | g10639.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 48 | 342 | 3.3E-113 |
| 3 | g10639.t1 | PANTHER | PTHR11351:SF91 | DESATURASE 1, ISOFORM A-RELATED | 48 | 342 | 3.3E-113 |
| 8 | g10639.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 60 | 80 | 3.6E-43 |
| 6 | g10639.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 105 | 125 | 3.6E-43 |
| 7 | g10639.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 142 | 171 | 3.6E-43 |
| 5 | g10639.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 234 | 255 | 3.6E-43 |
| 4 | g10639.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 277 | 291 | 3.6E-43 |
| 1 | g10639.t1 | Pfam | PF00487 | Fatty acid desaturase | 83 | 288 | 2.9E-17 |
| 16 | g10639.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 59 | - |
| 21 | g10639.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 60 | 78 | - |
| 18 | g10639.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 79 | 83 | - |
| 20 | g10639.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 108 | - |
| 15 | g10639.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 109 | 201 | - |
| 19 | g10639.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 202 | 222 | - |
| 17 | g10639.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 223 | 233 | - |
| 22 | g10639.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 234 | 254 | - |
| 14 | g10639.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 255 | 396 | - |
| 9 | g10639.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 60 | 79 | - |
| 11 | g10639.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 105 | - |
| 12 | g10639.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 202 | 224 | - |
| 10 | g10639.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 234 | 256 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed