General information for g11243.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Facilitated trehalose transporter Tret1.
Parent gene
- The parent gene g11243 is located on chr_1: 14871414..14872970 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11243 | g11243.t1 | isoform | g11243.t1 | 14871414 | 14872970 |
| chr_1 | g11243 | g11243.t1 | exon | g11243.t1.exon1 | 14871414 | 14871459 |
| chr_1 | g11243 | g11243.t1 | cds | g11243.t1.CDS1 | 14871414 | 14871459 |
| chr_1 | g11243 | g11243.t1 | exon | g11243.t1.exon2 | 14871511 | 14871776 |
| chr_1 | g11243 | g11243.t1 | cds | g11243.t1.CDS2 | 14871511 | 14871776 |
| chr_1 | g11243 | g11243.t1 | exon | g11243.t1.exon3 | 14871829 | 14871838 |
| chr_1 | g11243 | g11243.t1 | cds | g11243.t1.CDS3 | 14871829 | 14871838 |
| chr_1 | g11243 | g11243.t1 | exon | g11243.t1.exon4 | 14871917 | 14872656 |
| chr_1 | g11243 | g11243.t1 | cds | g11243.t1.CDS4 | 14871917 | 14872656 |
| chr_1 | g11243 | g11243.t1 | exon | g11243.t1.exon5 | 14872722 | 14872970 |
| chr_1 | g11243 | g11243.t1 | cds | g11243.t1.CDS5 | 14872722 | 14872970 |
| chr_1 | g11243 | g11243.t1 | TSS | g11243.t1 | NA | NA |
| chr_1 | g11243 | g11243.t1 | TTS | g11243.t1 | NA | NA |
Sequences
>g11243.t1 Gene=g11243 Length=1311
ATGAATAATTATAAAGTTTCAGCACAAGTTTTAGTGGCATCCATTGCGAGTATTGGAAGT
CTGCTCTATGGTATAGGTCTAGGATGGTCTTCTCCAAGTGGAGTAAAAATTTTAAATACT
GAGAAAAATTTTGAGATAACATCAAGTCAATTTTCATGGGTTGTCGCAATGAATTCTATT
GGTGGTTGTATTGGTTGTTTAGTAACTGGTCTCATTCGAAGTAATTATGGAACAAAAGTT
TCTATTTTTATATTTACTATTCCTAGCTTTAGCGGCTGGATGTTATTGGCATTTGCACAA
GCCTGGTGGATGTTGATTATAGAAATTCGTGGTGTTTTGCTAAGCTTTTATGAAATTACT
GTAAAATCAGGAATTTTGTTCAGTTATGCAATTGGTTCATTCACTCGACAGTCAATAACG
AATGCTATTTGTGGAGGAATTGTAGTTTTATATGCAATTGCATTCTTATTCATGCCTGAG
AGTCCATTGTATCTGATGAAACAACATAAAACTGAAGAGGCAAAAAAATCATTGACATAC
CTTCGTGGAAGAAACTACAAAATGGATGATGAGTTAACTAGACTTCATTTGGAAATCGAT
GAACTCGAGCGAAACACAAAACCCTTTTGGCAAGAAATCAGAACAAAAGCAACTCGCAAA
GCATTCGTGATTGTGATGTCAATGTTTATTTTCTTTCAATTGTGCGGAATTAATGCTATC
ATCTTCTATACAACAACAATTTTAATTGAGAGTGGCATAACGATTGATCCATTTATAGCT
ACATGCATGCTCGGTGTGATTCAAGTGATTGGAGTCTTGTGTTCTACAGCTTTGGTTGAT
CACTATGGAAGAAAAATTTTACTTATTGCTTCAAATATTATTATGATTTTTGGATTGTTA
GGTGTTGGTATATATTTTCATTTGAAGGAAAAAACTACTGTAACTAGCATTACATGGCTT
CCACTGGTATTATTTTGCATTTATTTCATTGGATTCTCAATTGGAGTTGGAAGCGTAACA
TATGTCTTAATGGGAGAATTAATTTCACTCAATGCAAAGAGAGTGATCGGACCAATGGCG
CAATTTTCAAACTTTCTAATGGCATTTCTGATTGCAATATTCTTTCCTAAAATTGCAAAT
TATATTGGAATGCATTATGCTTTCTATATTTTTGCAGCATTTTGTTTTATTGCTATTATA
TTTATTATAGTTATGCTACCAGAGACAAAAGGAAAATCTCTTGTTGAAATTCAAAATTTA
CTAACTAATGATAGAAAATGTGACACAAACAATTTTAAAAATAGATTTTAA
>g11243.t1 Gene=g11243 Length=436
MNNYKVSAQVLVASIASIGSLLYGIGLGWSSPSGVKILNTEKNFEITSSQFSWVVAMNSI
GGCIGCLVTGLIRSNYGTKVSIFIFTIPSFSGWMLLAFAQAWWMLIIEIRGVLLSFYEIT
VKSGILFSYAIGSFTRQSITNAICGGIVVLYAIAFLFMPESPLYLMKQHKTEEAKKSLTY
LRGRNYKMDDELTRLHLEIDELERNTKPFWQEIRTKATRKAFVIVMSMFIFFQLCGINAI
IFYTTTILIESGITIDPFIATCMLGVIQVIGVLCSTALVDHYGRKILLIASNIIMIFGLL
GVGIYFHLKEKTTVTSITWLPLVLFCIYFIGFSIGVGSVTYVLMGELISLNAKRVIGPMA
QFSNFLMAFLIAIFFPKIANYIGMHYAFYIFAAFCFIAIIFIIVMLPETKGKSLVEIQNL
LTNDRKCDTNNFKNRF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g11243.t1 | Coils | Coil | Coil | 185 | 205 | - |
| 10 | g11243.t1 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains | 6 | 424 | 7.6E-85 |
| 2 | g11243.t1 | PANTHER | PTHR48021:SF63 | GH07001P-RELATED | 8 | 106 | 1.6E-102 |
| 4 | g11243.t1 | PANTHER | PTHR48021 | - | 8 | 106 | 1.6E-102 |
| 3 | g11243.t1 | PANTHER | PTHR48021:SF63 | GH07001P-RELATED | 108 | 422 | 1.6E-102 |
| 5 | g11243.t1 | PANTHER | PTHR48021 | - | 108 | 422 | 1.6E-102 |
| 8 | g11243.t1 | PRINTS | PR00171 | Sugar transporter signature | 17 | 36 | 1.2E-5 |
| 6 | g11243.t1 | PRINTS | PR00171 | Sugar transporter signature | 232 | 242 | 1.2E-5 |
| 7 | g11243.t1 | PRINTS | PR00171 | Sugar transporter signature | 322 | 343 | 1.2E-5 |
| 1 | g11243.t1 | Pfam | PF00083 | Sugar (and other) transporter | 108 | 420 | 4.1E-56 |
| 21 | g11243.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 5 | - |
| 28 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 6 | 30 | - |
| 16 | g11243.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 31 | 50 | - |
| 32 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 51 | 74 | - |
| 20 | g11243.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 75 | 79 | - |
| 29 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 105 | - |
| 13 | g11243.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 106 | 111 | - |
| 30 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 112 | 132 | - |
| 18 | g11243.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 133 | 137 | - |
| 34 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 138 | 158 | - |
| 17 | g11243.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 159 | 220 | - |
| 24 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 243 | - |
| 19 | g11243.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 244 | 257 | - |
| 31 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 258 | 279 | - |
| 14 | g11243.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 280 | 285 | - |
| 27 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 286 | 307 | - |
| 22 | g11243.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 308 | 318 | - |
| 33 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 319 | 343 | - |
| 12 | g11243.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 344 | 354 | - |
| 26 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 355 | 375 | - |
| 23 | g11243.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 376 | 386 | - |
| 25 | g11243.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 387 | 406 | - |
| 15 | g11243.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 407 | 436 | - |
| 46 | g11243.t1 | ProSiteProfiles | PS50850 | Major facilitator superfamily (MFS) profile. | 1 | 410 | 15.418 |
| 9 | g11243.t1 | SUPERFAMILY | SSF103473 | MFS general substrate transporter | 12 | 416 | 1.7E-42 |
| 40 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 29 | - |
| 43 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 72 | - |
| 41 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 82 | 104 | - |
| 36 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 111 | 133 | - |
| 45 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 165 | - |
| 42 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 222 | 244 | - |
| 38 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 257 | 279 | - |
| 37 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 286 | 308 | - |
| 44 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 321 | 343 | - |
| 39 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 355 | 374 | - |
| 35 | g11243.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 384 | 406 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0055085 | transmembrane transport | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0022857 | transmembrane transporter activity | MF |
KEGG
Orthology
- This transcript has been annotated with K08139 (MFS transporter, SP family, sugar:H+ symporter)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed