Chromosome | Gene | Transcript | Category | ID | Start | End |
---|---|---|---|---|---|---|
chr_1 | g11289 | g11289.t11 | TTS | g11289.t11 | 15429083 | 15429083 |
chr_1 | g11289 | g11289.t11 | isoform | g11289.t11 | 15429166 | 15429885 |
chr_1 | g11289 | g11289.t11 | exon | g11289.t11.exon1 | 15429166 | 15429491 |
chr_1 | g11289 | g11289.t11 | cds | g11289.t11.CDS1 | 15429166 | 15429491 |
chr_1 | g11289 | g11289.t11 | exon | g11289.t11.exon2 | 15429873 | 15429885 |
chr_1 | g11289 | g11289.t11 | cds | g11289.t11.CDS2 | 15429873 | 15429885 |
chr_1 | g11289 | g11289.t11 | TSS | g11289.t11 | 15429913 | 15429913 |
>g11289.t11 Gene=g11289 Length=339
ATGTCGAAGAGAGGTGGTAAAAACTTGTATGTTATTGCTGTTCATGGCATTCGCGGTCGT
TTGAATCGTTTACCTTCAGCTGGTGTTGGTGACATGTTTGTCGCAACTGTAAAGAAGGGT
AAACCAGAATTGAGAAAGAAAGTAATGCCAGCAGTTGTCATTCGGCAGCGAAAACCGTTC
AGACGACGAGATGGAATCTTTATCTATTTTGAAGATAACGCCGGTGTAATTGTCAACAAT
AAAGGTGAAATGAAAGGATCAGCTATTACAGGTCCAGTTGCAAAAGAGTGTGCAGATTTA
TGGCCCCGTATTGCATCAAATGCTGGCTCAATAGCCTAA
>g11289.t11 Gene=g11289 Length=112
MSKRGGKNLYVIAVHGIRGRLNRLPSAGVGDMFVATVKKGKPELRKKVMPAVVIRQRKPF
RRRDGIFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNAGSIA
Transcript | Database | ID | Name | Start | End | E.value | |
---|---|---|---|---|---|---|---|
8 | g11289.t11 | Gene3D | G3DSA:2.40.150.20 | Ribosomal Protein L14; | 2 | 112 | 1.2E-54 |
4 | g11289.t11 | Hamap | MF_01367 | 50S ribosomal protein L14 [rplN]. | 1 | 112 | 15.325253 |
2 | g11289.t11 | PANTHER | PTHR11761 | 50S/60S RIBOSOMAL PROTEIN L14/L23 | 4 | 112 | 6.8E-62 |
3 | g11289.t11 | PANTHER | PTHR11761:SF22 | 60S RIBOSOMAL PROTEIN L23 | 4 | 112 | 6.8E-62 |
1 | g11289.t11 | Pfam | PF00238 | Ribosomal protein L14p/L23e | 5 | 110 | 2.1E-29 |
7 | g11289.t11 | ProSitePatterns | PS00049 | Ribosomal protein L14 signature. | 51 | 77 | - |
6 | g11289.t11 | SMART | SM01374 | Ribosomal_L14_2 | 1 | 112 | 6.6E-46 |
5 | g11289.t11 | SUPERFAMILY | SSF50193 | Ribosomal protein L14 | 5 | 111 | 3.27E-38 |
IUPRED3 score over 0.5 is predictive of a disordered region.
GOID | TERM | ONTOLOGY |
---|---|---|
GO:0005840 | ribosome | CC |
GO:0006412 | translation | BP |
GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed