General information for g11439.t16
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative MAP kinase-activated protein kinase 2.
Parent gene
- The parent gene g11439 is located on chr_1: 16251185..16252138 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11439 | g11439.t16 | TTS | g11439.t16 | 16251156 | 16251156 |
| chr_1 | g11439 | g11439.t16 | isoform | g11439.t16 | 16251185 | 16251899 |
| chr_1 | g11439 | g11439.t16 | exon | g11439.t16.exon1 | 16251185 | 16251250 |
| chr_1 | g11439 | g11439.t16 | cds | g11439.t16.CDS1 | 16251186 | 16251250 |
| chr_1 | g11439 | g11439.t16 | exon | g11439.t16.exon2 | 16251311 | 16251379 |
| chr_1 | g11439 | g11439.t16 | cds | g11439.t16.CDS2 | 16251311 | 16251379 |
| chr_1 | g11439 | g11439.t16 | exon | g11439.t16.exon3 | 16251437 | 16251518 |
| chr_1 | g11439 | g11439.t16 | cds | g11439.t16.CDS3 | 16251437 | 16251518 |
| chr_1 | g11439 | g11439.t16 | exon | g11439.t16.exon4 | 16251585 | 16251646 |
| chr_1 | g11439 | g11439.t16 | cds | g11439.t16.CDS4 | 16251585 | 16251646 |
| chr_1 | g11439 | g11439.t16 | exon | g11439.t16.exon5 | 16251773 | 16251899 |
| chr_1 | g11439 | g11439.t16 | cds | g11439.t16.CDS5 | 16251773 | 16251899 |
| chr_1 | g11439 | g11439.t16 | TSS | g11439.t16 | 16252138 | 16252138 |
Sequences
>g11439.t16 Gene=g11439 Length=406
ATGTTTAAAATTAATACAAATACGACTAATCCACCTCAAATGAGTACATCACAGAATTTC
ACTTTGGTTCCGAAAACAACAAGAATCACTGACGAATATGAGATATCGAACAATGTTTTG
GGATTAGGCATAAATGGAAAAGTTGTGCAATGCACAAGAAAAAGTGATAATACTAAATAC
GCATTGAAGGTACTACATGATAATAGCAAAGCACGGAGAGAAGTGGAATTGCATTGGCGT
GTTAGTGGTTGTCGACATATTGTGAATATTGTTGATGTTTTTGAGAACACTTATGGTGGC
ACAAAATGTTTGTTAGTTGTAATGGAACTCATGACTGGTGGTGAGCTCTTCAATCGTATC
CAAGAACGTCAAGATGGACCTTTTACTGAACGTGAAGCTGCGTATG
>g11439.t16 Gene=g11439 Length=135
MFKINTNTTNPPQMSTSQNFTLVPKTTRITDEYEISNNVLGLGINGKVVQCTRKSDNTKY
ALKVLHDNSKARREVELHWRVSGCRHIVNIVDVFENTYGGTKCLLVVMELMTGGELFNRI
QERQDGPFTEREAAY
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g11439.t16 | Gene3D | G3DSA:3.30.200.20 | Phosphorylase Kinase; domain 1 | 16 | 112 | 6.3E-41 |
| 2 | g11439.t16 | PANTHER | PTHR24349 | SERINE/THREONINE-PROTEIN KINASE | 15 | 134 | 1.2E-42 |
| 3 | g11439.t16 | PANTHER | PTHR24349:SF64 | MAP KINASE-ACTIVATED PROTEIN KINASE 3 | 15 | 134 | 1.2E-42 |
| 1 | g11439.t16 | Pfam | PF00069 | Protein kinase domain | 38 | 133 | 3.1E-13 |
| 5 | g11439.t16 | ProSitePatterns | PS00107 | Protein kinases ATP-binding region signature. | 40 | 63 | - |
| 7 | g11439.t16 | ProSiteProfiles | PS50011 | Protein kinase domain profile. | 34 | 135 | 10.86 |
| 4 | g11439.t16 | SUPERFAMILY | SSF56112 | Protein kinase-like (PK-like) | 21 | 134 | 1.2E-22 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005524 | ATP binding | MF |
| GO:0004672 | protein kinase activity | MF |
| GO:0006468 | protein phosphorylation | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
