General information for g11761.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as DnaJ homolog subfamily C member 5-like protein.
Parent gene
- The parent gene g11761 is located on chr_1: 18272504..18273267 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11761 | g11761.t1 | TTS | g11761.t1 | 18269616 | 18269616 |
| chr_1 | g11761 | g11761.t1 | isoform | g11761.t1 | 18270459 | 18273267 |
| chr_1 | g11761 | g11761.t1 | exon | g11761.t1.exon1 | 18270459 | 18270469 |
| chr_1 | g11761 | g11761.t1 | cds | g11761.t1.CDS1 | 18270459 | 18270469 |
| chr_1 | g11761 | g11761.t1 | exon | g11761.t1.exon2 | 18271241 | 18271403 |
| chr_1 | g11761 | g11761.t1 | cds | g11761.t1.CDS2 | 18271241 | 18271403 |
| chr_1 | g11761 | g11761.t1 | exon | g11761.t1.exon3 | 18271539 | 18271568 |
| chr_1 | g11761 | g11761.t1 | cds | g11761.t1.CDS3 | 18271539 | 18271568 |
| chr_1 | g11761 | g11761.t1 | exon | g11761.t1.exon4 | 18272306 | 18272434 |
| chr_1 | g11761 | g11761.t1 | cds | g11761.t1.CDS4 | 18272306 | 18272434 |
| chr_1 | g11761 | g11761.t1 | exon | g11761.t1.exon5 | 18272493 | 18272784 |
| chr_1 | g11761 | g11761.t1 | cds | g11761.t1.CDS5 | 18272493 | 18272784 |
| chr_1 | g11761 | g11761.t1 | exon | g11761.t1.exon6 | 18273248 | 18273267 |
| chr_1 | g11761 | g11761.t1 | cds | g11761.t1.CDS6 | 18273248 | 18273267 |
| chr_1 | g11761 | g11761.t1 | TSS | g11761.t1 | 18273485 | 18273485 |
Sequences
>g11761.t1 Gene=g11761 Length=645
ATGGATAAAAGAAAGCTATCCACCTCTGGCGATTCTTTATATGAAATTTTGGGACTGCCA
AAGACTTCATCACCAGAAGATATAAAGAAAACTTATAGAAAACTTGCTCTCAAATATCAT
CCAGATAAGAATCCTGAAAATCCTGAGGCTGCAGAAAAATTTAAAGAAGTCAATAGAGCA
CATAGCATATTAAGTGATCAAACTAAACGAAATATTTATGACAACTATGGTTCACTTGGA
TTATATATAGCTGAACAATTTGGTGAAGAAAATGTCAATGCATATTTTGTAGTGACATCA
CCTGCCTGCAAAGCACTTTTCTTGATTTGTTGTATTGCAACCGGTTGTTATTGCTGTTGC
TGTTGCTGCTGCTGCTGTAACTTTTGTTTTGGAAAATATAAACCTACACCACCTCCTGAT
GGCGACTATCATCATCTTAATAGAGATGGACCTGGAGCCTCAAAAATGCATGAGGATATG
AATGATGGAGAAGACATTGTCACATCTCAGCCAGGTCCAGGTCAGGCAACGTCAAATATT
CCAGCATTCGCTATGCCACCACCGTCAGCAACGAATCCATTTGCAAGTGAAACATCAAAT
CTTAATCAAGGTGGAACACGCACTTACACACCAGGCTTAAATTAA
>g11761.t1 Gene=g11761 Length=214
MDKRKLSTSGDSLYEILGLPKTSSPEDIKKTYRKLALKYHPDKNPENPEAAEKFKEVNRA
HSILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPACKALFLICCIATGCYCCC
CCCCCCNFCFGKYKPTPPPDGDYHHLNRDGPGASKMHEDMNDGEDIVTSQPGPGQATSNI
PAFAMPPPSATNPFASETSNLNQGGTRTYTPGLN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g11761.t1 | CDD | cd06257 | DnaJ | 14 | 66 | 2.43909E-28 |
| 8 | g11761.t1 | Gene3D | G3DSA:1.10.287.110 | - | 1 | 103 | 4.5E-35 |
| 12 | g11761.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 194 | 214 | - |
| 2 | g11761.t1 | PANTHER | PTHR44027 | DNAJ HOMOLOG SUBFAMILY C MEMBER 5 HOMOLOG | 2 | 205 | 2.6E-80 |
| 4 | g11761.t1 | PRINTS | PR00625 | DnaJ domain signature | 14 | 32 | 1.4E-25 |
| 3 | g11761.t1 | PRINTS | PR00625 | DnaJ domain signature | 32 | 47 | 1.4E-25 |
| 6 | g11761.t1 | PRINTS | PR00625 | DnaJ domain signature | 49 | 69 | 1.4E-25 |
| 5 | g11761.t1 | PRINTS | PR00625 | DnaJ domain signature | 69 | 88 | 1.4E-25 |
| 1 | g11761.t1 | Pfam | PF00226 | DnaJ domain | 13 | 74 | 9.6E-28 |
| 11 | g11761.t1 | ProSitePatterns | PS00636 | Nt-dnaJ domain signature. | 54 | 73 | - |
| 13 | g11761.t1 | ProSiteProfiles | PS50076 | dnaJ domain profile. | 12 | 77 | 23.704 |
| 10 | g11761.t1 | SMART | SM00271 | dnaj_3 | 11 | 69 | 2.8E-28 |
| 7 | g11761.t1 | SUPERFAMILY | SSF46565 | Chaperone J-domain | 12 | 100 | 1.71E-29 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K09525 (DnaJ homolog subfamily C member 5)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
