Chromosome | Gene | Transcript | Category | ID | Start | End |
---|---|---|---|---|---|---|
chr_1 | g11761 | g11761.t13 | isoform | g11761.t13 | 18272258 | 18273267 |
chr_1 | g11761 | g11761.t13 | exon | g11761.t13.exon1 | 18272258 | 18272434 |
chr_1 | g11761 | g11761.t13 | cds | g11761.t13.CDS1 | 18272258 | 18272434 |
chr_1 | g11761 | g11761.t13 | exon | g11761.t13.exon2 | 18272493 | 18272784 |
chr_1 | g11761 | g11761.t13 | cds | g11761.t13.CDS2 | 18272493 | 18272784 |
chr_1 | g11761 | g11761.t13 | exon | g11761.t13.exon3 | 18273248 | 18273267 |
chr_1 | g11761 | g11761.t13 | cds | g11761.t13.CDS3 | 18273248 | 18273267 |
chr_1 | g11761 | g11761.t13 | TSS | g11761.t13 | 18273485 | 18273485 |
chr_1 | g11761 | g11761.t13 | TTS | g11761.t13 | NA | NA |
>g11761.t13 Gene=g11761 Length=489
ATGGATAAAAGAAAGCTATCCACCTCTGGCGATTCTTTATATGAAATTTTGGGACTGCCA
AAGACTTCATCACCAGAAGATATAAAGAAAACTTATAGAAAACTTGCTCTCAAATATCAT
CCAGATAAGAATCCTGAAAATCCTGAGGCTGCAGAAAAATTTAAAGAAGTCAATAGAGCA
CATAGCATATTAAGTGATCAAACTAAACGAAATATTTATGACAACTATGGTTCACTTGGA
TTATATATAGCTGAACAATTTGGTGAAGAAAATGTCAATGCATATTTTGTAGTGACATCA
CCTGCCTGCAAAGCACTTTTCTTGATTTGTTGTATTGCAACCGGTTGTTATTGCTGTTGC
TGTTGCTGCTGCTGCTGTAACTTTTGTTTTGGAAAATATAAACCTACACCACCTCCTGAT
GGCGACTATCATCATCTTAATGTAATTATAACCTTTTTATTTAAATTACTTTTATTATAT
TTTGAAAAA
>g11761.t13 Gene=g11761 Length=163
MDKRKLSTSGDSLYEILGLPKTSSPEDIKKTYRKLALKYHPDKNPENPEAAEKFKEVNRA
HSILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPACKALFLICCIATGCYCCC
CCCCCCNFCFGKYKPTPPPDGDYHHLNVIITFLFKLLLLYFEK
Transcript | Database | ID | Name | Start | End | E.value | |
---|---|---|---|---|---|---|---|
14 | g11761.t13 | CDD | cd06257 | DnaJ | 14 | 66 | 4.74948E-27 |
8 | g11761.t13 | Gene3D | G3DSA:1.10.287.110 | - | 1 | 103 | 2.2E-35 |
2 | g11761.t13 | PANTHER | PTHR44027 | DNAJ HOMOLOG SUBFAMILY C MEMBER 5 HOMOLOG | 2 | 147 | 8.1E-75 |
4 | g11761.t13 | PRINTS | PR00625 | DnaJ domain signature | 14 | 32 | 6.5E-26 |
3 | g11761.t13 | PRINTS | PR00625 | DnaJ domain signature | 32 | 47 | 6.5E-26 |
6 | g11761.t13 | PRINTS | PR00625 | DnaJ domain signature | 49 | 69 | 6.5E-26 |
5 | g11761.t13 | PRINTS | PR00625 | DnaJ domain signature | 69 | 88 | 6.5E-26 |
1 | g11761.t13 | Pfam | PF00226 | DnaJ domain | 13 | 74 | 5.5E-28 |
9 | g11761.t13 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 104 | - |
13 | g11761.t13 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 131 | - |
11 | g11761.t13 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 132 | 142 | - |
12 | g11761.t13 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 161 | - |
10 | g11761.t13 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 162 | 163 | - |
18 | g11761.t13 | ProSitePatterns | PS00636 | Nt-dnaJ domain signature. | 54 | 73 | - |
19 | g11761.t13 | ProSiteProfiles | PS50076 | dnaJ domain profile. | 12 | 77 | 23.704 |
17 | g11761.t13 | SMART | SM00271 | dnaj_3 | 11 | 69 | 2.8E-28 |
7 | g11761.t13 | SUPERFAMILY | SSF46565 | Chaperone J-domain | 12 | 100 | 1.09E-29 |
16 | g11761.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 106 | 128 | - |
15 | g11761.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 161 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.