Chromosome | Gene | Transcript | Category | ID | Start | End |
---|---|---|---|---|---|---|
chr_1 | g11978 | g11978.t11 | TSS | g11978.t11 | 20131511 | 20131511 |
chr_1 | g11978 | g11978.t11 | isoform | g11978.t11 | 20131584 | 20132276 |
chr_1 | g11978 | g11978.t11 | exon | g11978.t11.exon1 | 20131584 | 20131846 |
chr_1 | g11978 | g11978.t11 | cds | g11978.t11.CDS1 | 20131584 | 20131846 |
chr_1 | g11978 | g11978.t11 | exon | g11978.t11.exon2 | 20131903 | 20131949 |
chr_1 | g11978 | g11978.t11 | cds | g11978.t11.CDS2 | 20131903 | 20131949 |
chr_1 | g11978 | g11978.t11 | exon | g11978.t11.exon3 | 20132053 | 20132276 |
chr_1 | g11978 | g11978.t11 | cds | g11978.t11.CDS3 | 20132053 | 20132096 |
chr_1 | g11978 | g11978.t11 | TTS | g11978.t11 | 20132272 | 20132272 |
>g11978.t11 Gene=g11978 Length=534
ATGAGTGTTTTTGATACATTAAATTACAATAACTATGCATTTCGCGTTTATATTACTTGG
GGAGGATTACTCCTTATTAAATTGCTATTTATGGCATTTTTGACATCATTTCAACGAATT
CGTAAAGGAGCTGTCGAAAATCCAGAAGATGTTGGTGTTCGCTCAAATATGGAGATCAAG
AAAGATGAAGATGTAGAGCGAGTGAGACGTGCTCATTTGAATGACCTTGAAAATATTCCA
GCATTTTTGTTTGCCGCATTGATGTATATTATGGCTGATCCTCATCCTATTGCCGCAGCA
TGGTTAATTCTTACCCTATTCGTCAACCTGCAAGAGGAATTTGCTTCTTCATAACTCTTG
GCATCACTGTCTTTATGATTATATGGTCAATGGTTATATTTTTCGAGATCTAAATAAGAT
AGTTTTCATAATATGTCCTTGAGATTAATTTCTATATGATAAATGTGCTTATAGATTAGT
ATTAAATGTGTGTGAAAATCAAAAATAATAAATGTGAATTAATAATCTACAAAA
>g11978.t11 Gene=g11978 Length=117
MSVFDTLNYNNYAFRVYITWGGLLLIKLLFMAFLTSFQRIRKGAVENPEDVGVRSNMEIK
KDEDVERVRRAHLNDLENIPAFLFAALMYIMADPHPIAAAWLILTLFVNLQEEFASS
Transcript | Database | ID | Name | Start | End | E.value | |
---|---|---|---|---|---|---|---|
7 | g11978.t11 | Gene3D | G3DSA:1.20.120.550 | - | 3 | 109 | 1.3E-34 |
2 | g11978.t11 | PANTHER | PTHR10689 | MICROSOMAL GLUTATHIONE S-TRANSFERASE 1 | 6 | 105 | 2.0E-27 |
3 | g11978.t11 | PANTHER | PTHR10689:SF6 | IP20101P-RELATED | 6 | 105 | 2.0E-27 |
1 | g11978.t11 | Pfam | PF01124 | MAPEG family | 18 | 107 | 6.2E-15 |
10 | g11978.t11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
12 | g11978.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
8 | g11978.t11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 35 | 78 | - |
11 | g11978.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 104 | - |
9 | g11978.t11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 105 | 117 | - |
6 | g11978.t11 | SUPERFAMILY | SSF161084 | MAPEG domain-like | 13 | 106 | 1.57E-22 |
5 | g11978.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 37 | - |
4 | g11978.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 82 | 104 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.