General information for g12222.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Acyl-CoA Delta(11) desaturase.
Parent gene
- The parent gene g12222 is located on chr_1: 21798310..21799934 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12222 | g12222.t1 | isoform | g12222.t1 | 21798310 | 21799934 |
| chr_1 | g12222 | g12222.t1 | exon | g12222.t1.exon1 | 21798310 | 21798403 |
| chr_1 | g12222 | g12222.t1 | cds | g12222.t1.CDS1 | 21798310 | 21798403 |
| chr_1 | g12222 | g12222.t1 | exon | g12222.t1.exon2 | 21798696 | 21799409 |
| chr_1 | g12222 | g12222.t1 | cds | g12222.t1.CDS2 | 21798696 | 21799409 |
| chr_1 | g12222 | g12222.t1 | exon | g12222.t1.exon3 | 21799476 | 21799495 |
| chr_1 | g12222 | g12222.t1 | cds | g12222.t1.CDS3 | 21799476 | 21799495 |
| chr_1 | g12222 | g12222.t1 | exon | g12222.t1.exon4 | 21799563 | 21799650 |
| chr_1 | g12222 | g12222.t1 | cds | g12222.t1.CDS4 | 21799563 | 21799650 |
| chr_1 | g12222 | g12222.t1 | exon | g12222.t1.exon5 | 21799711 | 21799934 |
| chr_1 | g12222 | g12222.t1 | cds | g12222.t1.CDS5 | 21799711 | 21799934 |
| chr_1 | g12222 | g12222.t1 | TSS | g12222.t1 | NA | NA |
| chr_1 | g12222 | g12222.t1 | TTS | g12222.t1 | NA | NA |
Sequences
>g12222.t1 Gene=g12222 Length=1140
ATGGTCACAAAATTTATAGATCGTTTGGTGGACAGAAAGAAAAAAAGTGATGAAGTGATT
GATAGCAATAATAATGTTGTTAAAGATTTTAAAGATGTAGAGAGACCATCATTATGTGGT
GAAGATGATTACAAACTAGAAATTGTATGGAGAAATGTCTTTATTTTTCTCTACCTTCAT
GCTTGTGCTGTATATGGATTTTTATTACCAAAAGTGACTTGGTCCGGTGTTGTTTTGGCA
TGGGCTTATGGTTTTATGTGTGCATTTGGAACGACTATCGGAGCTCACCGTCTTTATACA
CATCGAGCTTTTAGAGCTAACAAACCATTGCAATGCATTTTGCTCTTCTGGCAAACAATG
GCAATGCAAAATTCAATGTACGAGTGGGTGAGAGATCATCGAGTTCATCATAAATATACT
GATACAAATGCTGATCCACACAATGCTAAACGAGGCTTCTTTTTCTCTCATATGGGCTGG
CTGATGTGCAAAAAGCATCCAGATGTAAAAAAGTTTGGTGCAAAGATCGACATGAGTGAC
TTAGAAAATGATCCACTTGTGATGTTCCAACATAAAAATTATTTACCTTTGGCTCTTCTT
GTTGGATTGATTATTCCAATACTTTTGGGTCTTTATTGTGGTGAAAGTTTTACTGTTGTC
TGGCATGGACATATTTTAAGATATTTAGTTGGTTTACATCTTGTCTGGTGTATCAATTCA
GTTGCGCATTATTGGGGAACAAAACCTTATGACAAATATATAACTTCAACTGATTCTTAT
CTTGTTGGAACTTTTGGGTTGGGTGAAGGTTGGCATAATTACCATCACGTTTTTCCTTTT
GACTATAAATGTGCAGAGTTACCAACTTATTGGTGCAATTTATCACTCATGTTGATTGAC
TTTTTTGCTTATATTGGTTGGGCAACTGATCTGAAGACAGTTTCACCAGCAACAGTGATG
AGAAGAATTGAAAGAACTGGAGATGGAACAAAGGAAATTTACTATAAAGAAGAAGGAAAT
TCAAAATGTATAGAAATATATACAGATAGTAAGAATAATGATATTTGGGGATTTGATGAC
ACTGATATGACAGCTGAGTATAAAAGTTGTATTGATATTTATAACAAAAAATTTGATTAA
>g12222.t1 Gene=g12222 Length=379
MVTKFIDRLVDRKKKSDEVIDSNNNVVKDFKDVERPSLCGEDDYKLEIVWRNVFIFLYLH
ACAVYGFLLPKVTWSGVVLAWAYGFMCAFGTTIGAHRLYTHRAFRANKPLQCILLFWQTM
AMQNSMYEWVRDHRVHHKYTDTNADPHNAKRGFFFSHMGWLMCKKHPDVKKFGAKIDMSD
LENDPLVMFQHKNYLPLALLVGLIIPILLGLYCGESFTVVWHGHILRYLVGLHLVWCINS
VAHYWGTKPYDKYITSTDSYLVGTFGLGEGWHNYHHVFPFDYKCAELPTYWCNLSLMLID
FFAYIGWATDLKTVSPATVMRRIERTGDGTKEIYYKEEGNSKCIEIYTDSKNNDIWGFDD
TDMTAEYKSCIDIYNKKFD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 24 | g12222.t1 | CDD | cd03505 | Delta9-FADS-like | 73 | 312 | 1.89481E-68 |
| 2 | g12222.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 29 | 351 | 1.3E-115 |
| 3 | g12222.t1 | PANTHER | PTHR11351:SF31 | RE43130P | 29 | 351 | 1.3E-115 |
| 4 | g12222.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 50 | 70 | 2.5E-50 |
| 10 | g12222.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 73 | 95 | 2.5E-50 |
| 5 | g12222.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 96 | 116 | 2.5E-50 |
| 6 | g12222.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 133 | 162 | 2.5E-50 |
| 9 | g12222.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 194 | 212 | 2.5E-50 |
| 7 | g12222.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 225 | 246 | 2.5E-50 |
| 8 | g12222.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 268 | 282 | 2.5E-50 |
| 1 | g12222.t1 | Pfam | PF00487 | Fatty acid desaturase | 73 | 288 | 8.8E-17 |
| 15 | g12222.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 47 | - |
| 23 | g12222.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 68 | - |
| 19 | g12222.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 69 | 79 | - |
| 20 | g12222.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 99 | - |
| 17 | g12222.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 100 | 193 | - |
| 22 | g12222.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 194 | 213 | - |
| 18 | g12222.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 214 | 224 | - |
| 21 | g12222.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 225 | 245 | - |
| 16 | g12222.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 246 | 379 | - |
| 12 | g12222.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 67 | - |
| 13 | g12222.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 99 | - |
| 11 | g12222.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 197 | 219 | - |
| 14 | g12222.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 224 | 246 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
- This transcript has been annotated with K23054 (sn-1 stearoyl-lipid 9-desaturase)
Pathway
This gene does not belong to any pathways.
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
