General information for g1286.t9
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Transmembrane emp24 domain-containing protein bai.
Parent gene
- The parent gene g1286 is located on chr_3: 9431414..9431695 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1286 | g1286.t9 | TSS | g1286.t9 | 9430319 | 9430319 |
| chr_3 | g1286 | g1286.t9 | isoform | g1286.t9 | 9430438 | 9431531 |
| chr_3 | g1286 | g1286.t9 | exon | g1286.t9.exon1 | 9430438 | 9430574 |
| chr_3 | g1286 | g1286.t9 | cds | g1286.t9.CDS1 | 9430438 | 9430574 |
| chr_3 | g1286 | g1286.t9 | exon | g1286.t9.exon2 | 9430645 | 9430811 |
| chr_3 | g1286 | g1286.t9 | cds | g1286.t9.CDS2 | 9430645 | 9430811 |
| chr_3 | g1286 | g1286.t9 | exon | g1286.t9.exon3 | 9430869 | 9430943 |
| chr_3 | g1286 | g1286.t9 | cds | g1286.t9.CDS3 | 9430869 | 9430943 |
| chr_3 | g1286 | g1286.t9 | exon | g1286.t9.exon4 | 9431241 | 9431354 |
| chr_3 | g1286 | g1286.t9 | cds | g1286.t9.CDS4 | 9431241 | 9431354 |
| chr_3 | g1286 | g1286.t9 | exon | g1286.t9.exon5 | 9431413 | 9431531 |
| chr_3 | g1286 | g1286.t9 | cds | g1286.t9.CDS5 | 9431413 | 9431531 |
| chr_3 | g1286 | g1286.t9 | TTS | g1286.t9 | 9431763 | 9431763 |
Sequences
>g1286.t9 Gene=g1286 Length=612
ATGAAAACAAAAGTGGGATTAGTCGTTTTAGGCTTAATTTGCTTATTTGCAAACGTAAGA
GCAATTCGATTTAATTTGCAGCCAAATACACAAAAATGTTTAAGAGATGAAATAAATGCA
AATGTTTTGGTTGTTGGAGAATATGAAGTGTCACAAGCTCCCGGACAAGTAATTGATTAT
GAAGTCCGTGATACAAAGCAACACATTTTGTCTAAAAAGGAAGATATCTCAAGAGGAAAG
TTTAGTTTCACATCAGAAGTTTTTGATGTTTATGAGTTATGTTTTATCTCAAAAGTTCCA
CACAACGTTCGTGGTATTGTTCAAGAAATAAATATCAATATTAAAAAAGGTGTTGAGACA
AAATCATATGAAGGCGTAACCAAATTGAAGCCACTTGAATTAGAGCTTAAGAAGCTCGAA
GATCTTTCAGATGCCATTGTTCAAGATTTTGCGTTAATGAGAAAACGTGAAGAAGAAATG
AGAGATACAAATGAATCAACAAACAATAGAGTTTTATTCTTCAGTATATTTGGAATGTGC
TGTCTTTTAGGACTCGCTACATGGCAAGTGCTTTATCTTAGAAGATATTTCATTGCTAAG
AAGCTCATTTGA
>g1286.t9 Gene=g1286 Length=203
MKTKVGLVVLGLICLFANVRAIRFNLQPNTQKCLRDEINANVLVVGEYEVSQAPGQVIDY
EVRDTKQHILSKKEDISRGKFSFTSEVFDVYELCFISKVPHNVRGIVQEININIKKGVET
KSYEGVTKLKPLELELKKLEDLSDAIVQDFALMRKREEEMRDTNESTNNRVLFFSIFGMC
CLLGLATWQVLYLRRYFIAKKLI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g1286.t9 | PANTHER | PTHR22811:SF183 | TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN 10 | 16 | 202 | 6.0E-62 |
| 3 | g1286.t9 | PANTHER | PTHR22811 | TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN | 16 | 202 | 6.0E-62 |
| 1 | g1286.t9 | Pfam | PF01105 | emp24/gp25L/p24 family/GOLD | 21 | 197 | 1.8E-41 |
| 11 | g1286.t9 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 21 | - |
| 12 | g1286.t9 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 4 | - |
| 13 | g1286.t9 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 5 | 16 | - |
| 15 | g1286.t9 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 17 | 21 | - |
| 10 | g1286.t9 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 22 | 170 | - |
| 14 | g1286.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 171 | 193 | - |
| 9 | g1286.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 194 | 203 | - |
| 8 | g1286.t9 | ProSiteProfiles | PS50866 | GOLD domain profile. | 31 | 116 | 13.198 |
| 6 | g1286.t9 | SMART | SM01190 | EMP24_GP25L_2 | 21 | 198 | 4.8E-60 |
| 7 | g1286.t9 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 21 | - |
| 5 | g1286.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 5 | 22 | - |
| 4 | g1286.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 171 | 193 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K20352 (p24 family protein delta-1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed