General information for g13016.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g13016 is located on chr_1: 27524662..27525018 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13016 | g13016.t1 | TTS | g13016.t1 | 27523717 | 27523717 |
| chr_1 | g13016 | g13016.t1 | isoform | g13016.t1 | 27524662 | 27525018 |
| chr_1 | g13016 | g13016.t1 | exon | g13016.t1.exon1 | 27524662 | 27524763 |
| chr_1 | g13016 | g13016.t1 | cds | g13016.t1.CDS1 | 27524662 | 27524763 |
| chr_1 | g13016 | g13016.t1 | exon | g13016.t1.exon2 | 27524824 | 27525018 |
| chr_1 | g13016 | g13016.t1 | cds | g13016.t1.CDS2 | 27524824 | 27525018 |
| chr_1 | g13016 | g13016.t1 | TSS | g13016.t1 | NA | NA |
Sequences
>g13016.t1 Gene=g13016 Length=297
ATGAAGAAAATTTATATTGTCGGTGCAGGCATCTGTGGAATCTCAGCTGCTGTGCAAATT
GCAGAAAATTTCAAGAATCAAAATGTTGAAGTGATTGTTATAGCTGAGAAATTTACACCA
AATACAACAAGTGATTTAGTTGCTGGCCTATGGGGTCCTTATCTAATGGGCAGCACTCCA
GAGACACAAAATTGTTCAATGGTCGAACCACACGAATATTTTCATCATTTATGGTTGAAT
GGATTGGCAGAAGAAGCTAGGCATAACGATGATTCCTTGCTATCGTTTGTCAGCTGA
>g13016.t1 Gene=g13016 Length=98
MKKIYIVGAGICGISAAVQIAENFKNQNVEVIVIAEKFTPNTTSDLVAGLWGPYLMGSTP
ETQNCSMVEPHEYFHHLWLNGLAEEARHNDDSLLSFVS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g13016.t1 | Gene3D | G3DSA:3.40.50.720 | - | 2 | 97 | 3.8E-20 |
| 1 | g13016.t1 | PANTHER | PTHR11530 | D-AMINO ACID OXIDASE | 3 | 69 | 4.7E-12 |
| 2 | g13016.t1 | PANTHER | PTHR11530:SF11 | D-ASPARTATE OXIDASE | 3 | 69 | 4.7E-12 |
| 6 | g13016.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 17 | - |
| 7 | g13016.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 8 | g13016.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 12 | - |
| 9 | g13016.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 13 | 17 | - |
| 5 | g13016.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 18 | 98 | - |
| 3 | g13016.t1 | SUPERFAMILY | SSF51971 | Nucleotide-binding domain | 1 | 60 | 1.02E-6 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0046416 | D-amino acid metabolic process | BP |
| GO:0003884 | D-amino-acid oxidase activity | MF |
| GO:0071949 | FAD binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed