Chromosome | Gene | Transcript | Category | ID | Start | End |
---|---|---|---|---|---|---|
chr_1 | g13237 | g13237.t11 | TSS | g13237.t11 | 28731447 | 28731447 |
chr_1 | g13237 | g13237.t11 | isoform | g13237.t11 | 28731496 | 28732519 |
chr_1 | g13237 | g13237.t11 | exon | g13237.t11.exon1 | 28731496 | 28731563 |
chr_1 | g13237 | g13237.t11 | exon | g13237.t11.exon2 | 28731852 | 28731942 |
chr_1 | g13237 | g13237.t11 | exon | g13237.t11.exon3 | 28732075 | 28732519 |
chr_1 | g13237 | g13237.t11 | cds | g13237.t11.CDS1 | 28732118 | 28732519 |
chr_1 | g13237 | g13237.t11 | TTS | g13237.t11 | 28732729 | 28732729 |
>g13237.t11 Gene=g13237 Length=604
ATAGTACTACACAACAGTGTTTTGAAGTGTTGACAACTACAGACAATTTGACTAAAACTT
GTAAAAAGATGATTTCTAGAGTATCCTCTTTTTTTCGTGCTCATCCAATGTTGAAAGGTA
TGGCCGTTTATGCATTTATCTGGCCAACAAGTGCAAGCAGTGACTAAAATTATTACCGTT
CTAGGTTCATCTGTCATCGAACATGTGGAGTGAAATGACTTTAAAAACAGGGATTACAAA
AGCTGTTGTTGAACAATTTTCTTATGGACCAGCTGCAAGTGTGAGTTTTTTTACAATCAT
GACTTTGCTTGAAGGACGATCATTCTCAGAAGCTAAAATGGAAGTTAGAGAGAAATTTCC
TCAAACTTTTCAAGTGGGAGTTTGTTTTTGGCCATTTTTCCAAATTATCAATTTTACGTT
TATTAAAGAACGAAATCGTGTACCTTTCGTAGCATTTGGTAGCTTTATATGGACAATATT
TCTTGCTTACATGAAAACACTTGATACACAAAAATTACATGAAGTTCATGTTCAAGAACA
TGAACATCCTACACATACGTTCTTTGAAAAGCTTAAAATAAACTTGCAAATCGGTACAGA
ATAA
>g13237.t11 Gene=g13237 Length=133
MWSEMTLKTGITKAVVEQFSYGPAASVSFFTIMTLLEGRSFSEAKMEVREKFPQTFQVGV
CFWPFFQIINFTFIKERNRVPFVAFGSFIWTIFLAYMKTLDTQKLHEVHVQEHEHPTHTF
FEKLKINLQIGTE
Transcript | Database | ID | Name | Start | End | E.value | |
---|---|---|---|---|---|---|---|
2 | g13237.t11 | PANTHER | PTHR11266 | PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 MPV17 | 1 | 104 | 2.2E-40 |
3 | g13237.t11 | PANTHER | PTHR11266:SF75 | IP10007P | 1 | 104 | 2.2E-40 |
1 | g13237.t11 | Pfam | PF04117 | Mpv17 / PMP22 family | 35 | 94 | 5.6E-19 |
10 | g13237.t11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
13 | g13237.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 36 | - |
8 | g13237.t11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 37 | 55 | - |
12 | g13237.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 56 | 74 | - |
9 | g13237.t11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 75 | 79 | - |
11 | g13237.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 97 | - |
7 | g13237.t11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 98 | 133 | - |
5 | g13237.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 19 | 41 | - |
6 | g13237.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 56 | 73 | - |
4 | g13237.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 97 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
GOID | TERM | ONTOLOGY |
---|---|---|
GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.