General information for g14071.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative 60S ribosomal protein L26.
Parent gene
- The parent gene g14071 is located on chr_1: 34479032..34479589 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g14071 | g14071.t10 | TSS | g14071.t10 | 34478846 | 34478846 |
| chr_1 | g14071 | g14071.t10 | isoform | g14071.t10 | 34478847 | 34479495 |
| chr_1 | g14071 | g14071.t10 | exon | g14071.t10.exon1 | 34478847 | 34479027 |
| chr_1 | g14071 | g14071.t10 | cds | g14071.t10.CDS1 | 34478860 | 34479027 |
| chr_1 | g14071 | g14071.t10 | exon | g14071.t10.exon2 | 34479211 | 34479360 |
| chr_1 | g14071 | g14071.t10 | cds | g14071.t10.CDS2 | 34479211 | 34479360 |
| chr_1 | g14071 | g14071.t10 | exon | g14071.t10.exon3 | 34479458 | 34479495 |
| chr_1 | g14071 | g14071.t10 | cds | g14071.t10.CDS3 | 34479458 | 34479493 |
| chr_1 | g14071 | g14071.t10 | TTS | g14071.t10 | 34479591 | 34479591 |
Sequences
>g14071.t10 Gene=g14071 Length=369
GAAATTCCACAAAATGAAGTTTAATAGAAACGTCTCATCATCGCGTCGCAAGAGTCGTCT
TCGACATTTTACAGCTCCATCGCATATTCGTAGAAAGATAATGTCATCACCATTGAGCAA
AGAACTCAGACAAAAATATAATGTTCGCTCAATGCCAATTCGTAAAGATGATGAAGTTCA
AGTCGTTCGTGGTCACTATAAAGGAAATCAAGTTGGCAAAGTAGTGCAAGTGTACAGAAA
GAAATTTGTTGTGTACATTGAACGAATCCAGCGCGAGAAGGCAAATGGAACTAATGTTTA
TGTTGGAATTCATCCATCAAAACTTTTGATTAAGAAACAGCTGCTGCTCCAATGGAAACT
ACATCCTAA
>g14071.t10 Gene=g14071 Length=118
MKFNRNVSSSRRKSRLRHFTAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG
HYKGNQVGKVVQVYRKKFVVYIERIQREKANGTNVYVGIHPSKLLIKKQLLLQWKLHP
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g14071.t10 | CDD | cd06089 | KOW_RPL26 | 52 | 102 | 1.35322E-12 |
| 7 | g14071.t10 | Gene3D | G3DSA:2.30.30.30 | - | 1 | 115 | 4.6E-52 |
| 3 | g14071.t10 | PANTHER | PTHR11143 | 60S RIBOSOMAL PROTEIN L26 FAMILY MEMBER | 1 | 108 | 3.3E-63 |
| 4 | g14071.t10 | PANTHER | PTHR11143:SF10 | 60S RIBOSOMAL PROTEIN L26-LIKE 1 | 1 | 108 | 3.3E-63 |
| 1 | g14071.t10 | Pfam | PF16906 | Ribosomal proteins L26 eukaryotic, L24P archaeal | 8 | 109 | 1.4E-32 |
| 2 | g14071.t10 | Pfam | PF00467 | KOW motif | 51 | 83 | 1.0E-7 |
| 9 | g14071.t10 | ProSitePatterns | PS01108 | Ribosomal protein L24 signature. | 52 | 70 | - |
| 10 | g14071.t10 | SMART | SM00739 | kow_9 | 48 | 76 | 0.0026 |
| 5 | g14071.t10 | SUPERFAMILY | SSF50104 | Translation proteins SH3-like domain | 8 | 108 | 8.27E-32 |
| 6 | g14071.t10 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 10 | - |
| 11 | g14071.t10 | TIGRFAM | TIGR01080 | rplX_A_E: ribosomal protein uL24 | 8 | 108 | 4.6E-42 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0003723 | RNA binding | MF |
| GO:0015934 | large ribosomal subunit | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
