General information for g1435.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g1435 is located on chr_3: 10974200..10979430 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1435 | g1435.t1 | TSS | g1435.t1 | 10973576 | 10973576 |
| chr_3 | g1435 | g1435.t1 | isoform | g1435.t1 | 10974200 | 10979430 |
| chr_3 | g1435 | g1435.t1 | exon | g1435.t1.exon1 | 10974200 | 10974326 |
| chr_3 | g1435 | g1435.t1 | cds | g1435.t1.CDS1 | 10974200 | 10974326 |
| chr_3 | g1435 | g1435.t1 | exon | g1435.t1.exon2 | 10974767 | 10974836 |
| chr_3 | g1435 | g1435.t1 | cds | g1435.t1.CDS2 | 10974767 | 10974836 |
| chr_3 | g1435 | g1435.t1 | exon | g1435.t1.exon3 | 10978372 | 10978440 |
| chr_3 | g1435 | g1435.t1 | cds | g1435.t1.CDS3 | 10978372 | 10978440 |
| chr_3 | g1435 | g1435.t1 | exon | g1435.t1.exon4 | 10978498 | 10978544 |
| chr_3 | g1435 | g1435.t1 | cds | g1435.t1.CDS4 | 10978498 | 10978544 |
| chr_3 | g1435 | g1435.t1 | exon | g1435.t1.exon5 | 10978611 | 10978702 |
| chr_3 | g1435 | g1435.t1 | cds | g1435.t1.CDS5 | 10978611 | 10978702 |
| chr_3 | g1435 | g1435.t1 | exon | g1435.t1.exon6 | 10978759 | 10978911 |
| chr_3 | g1435 | g1435.t1 | cds | g1435.t1.CDS6 | 10978759 | 10978911 |
| chr_3 | g1435 | g1435.t1 | exon | g1435.t1.exon7 | 10979326 | 10979430 |
| chr_3 | g1435 | g1435.t1 | cds | g1435.t1.CDS7 | 10979326 | 10979430 |
| chr_3 | g1435 | g1435.t1 | TTS | g1435.t1 | NA | NA |
Sequences
>g1435.t1 Gene=g1435 Length=663
ATGGGAGCATTGATTGAAGTCAAAGTGGACAAACAAAAGGCCAACTATCTCTTGAATACT
GCCTTAAAATTCCTTAGGAAACATAGGATTGTTAGAGGAATGCTTAGTTATAGCATTCTA
TGGCCTGTTGGATGTATGTTACAACAGACTTTTGAAGGCAAGAGTATTAGTGAATACGAT
TGGAAAAGGATTTTGAGATTTTGTATTTATGGAACGTTCATTCAAGGACCAGCTCTTTAC
TGTTGGATTCGAGTTGCTAATAAAATGTGGCCACGTAGTGATATTCGTTCATCATTAGCC
AAAGCATTCACAGAGCAATTTGCATTTGATCCATTCTCAATAACATCATTTTTGTATATT
ATGAGTGTCCTCGAGGGAAGAACTCATGAGCAAGCTAAAGATGAGGTTTCTATAAAATTC
ATGAATATTTATGCAGTCGGCTTTATTTATTGGCCAATAGCGCAAACGATCAACTTTTCA
CTTATTAAACCCAAAAATCAAGTTATTTATGCATCATTTGCTAGTCTTATCTGGACAACT
TTCTTGGCTTACATTAAGTCACATCCAATTGATGAAGAAGTTAAAAGAAGAATGAAAGCA
AGAATAAAGAAACGTTATGATAATCTGAAAGAACGTTACGAACATTTAAAAAAGCATGAA
TAA
>g1435.t1 Gene=g1435 Length=220
MGALIEVKVDKQKANYLLNTALKFLRKHRIVRGMLSYSILWPVGCMLQQTFEGKSISEYD
WKRILRFCIYGTFIQGPALYCWIRVANKMWPRSDIRSSLAKAFTEQFAFDPFSITSFLYI
MSVLEGRTHEQAKDEVSIKFMNIYAVGFIYWPIAQTINFSLIKPKNQVIYASFASLIWTT
FLAYIKSHPIDEEVKRRMKARIKKRYDNLKERYEHLKKHE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g1435.t1 | Coils | Coil | Coil | 199 | 219 | - |
| 2 | g1435.t1 | PANTHER | PTHR11266:SF26 | IP08061P | 25 | 191 | 6.9E-77 |
| 3 | g1435.t1 | PANTHER | PTHR11266 | PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 MPV17 | 25 | 191 | 6.9E-77 |
| 1 | g1435.t1 | Pfam | PF04117 | Mpv17 / PMP22 family | 122 | 182 | 3.4E-18 |
| 10 | g1435.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 29 | - |
| 14 | g1435.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 30 | 51 | - |
| 12 | g1435.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 52 | 62 | - |
| 17 | g1435.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 63 | 83 | - |
| 11 | g1435.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 84 | 142 | - |
| 16 | g1435.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 162 | - |
| 13 | g1435.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 163 | 167 | - |
| 15 | g1435.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 168 | 185 | - |
| 9 | g1435.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 186 | 220 | - |
| 6 | g1435.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 64 | 86 | - |
| 5 | g1435.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 106 | 123 | - |
| 4 | g1435.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 136 | 153 | - |
| 7 | g1435.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 168 | 190 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K13349 (Mpv17-like protein)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed