General information for g14675.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g14675 is located on chr_4: 1849262..1849869 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g14675 | g14675.t1 | TTS | g14675.t1 | 1849216 | 1849216 |
| chr_4 | g14675 | g14675.t1 | isoform | g14675.t1 | 1849262 | 1849869 |
| chr_4 | g14675 | g14675.t1 | exon | g14675.t1.exon1 | 1849262 | 1849424 |
| chr_4 | g14675 | g14675.t1 | cds | g14675.t1.CDS1 | 1849262 | 1849424 |
| chr_4 | g14675 | g14675.t1 | exon | g14675.t1.exon2 | 1849523 | 1849623 |
| chr_4 | g14675 | g14675.t1 | cds | g14675.t1.CDS2 | 1849523 | 1849623 |
| chr_4 | g14675 | g14675.t1 | exon | g14675.t1.exon3 | 1849843 | 1849869 |
| chr_4 | g14675 | g14675.t1 | cds | g14675.t1.CDS3 | 1849843 | 1849869 |
| chr_4 | g14675 | g14675.t1 | TSS | g14675.t1 | 1849929 | 1849929 |
Sequences
>g14675.t1 Gene=g14675 Length=291
ATGCAAACTGAAAAGAAAATTACAGAAATTGCTGGTGATGAGCATGATAATCAAACTTCA
TCAACGTTTGTCATAGAAGGCGAAGGACATACATTAGGAAATATTTTGAAAAACATCATT
TCTAATTATGCTGATGTACAATTTTGTGGCTACACACTTCCTCATCCAGTTGAAAATAAA
ATTCATTTTAGAATTCAATCAACAGGAAAAACAAAAGCAATTGAAATTCTTAAAAGAGGA
CTTGAAGACATAAAGTTTATTTGTGACACAGTCTTAGAAACTCCAATGTAA
>g14675.t1 Gene=g14675 Length=96
MQTEKKITEIAGDEHDNQTSSTFVIEGEGHTLGNILKNIISNYADVQFCGYTLPHPVENK
IHFRIQSTGKTKAIEILKRGLEDIKFICDTVLETPM
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g14675.t1 | CDD | cd07029 | RNAP_I_III_AC19 | 16 | 94 | 1.12321E-35 |
| 7 | g14675.t1 | Gene3D | G3DSA:3.30.1360.10 | - | 2 | 95 | 1.8E-30 |
| 6 | g14675.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 20 | - |
| 2 | g14675.t1 | PANTHER | PTHR13946:SF28 | DNA-DIRECTED RNA POLYMERASES I AND III SUBUNIT RPAC2 | 14 | 94 | 3.6E-24 |
| 3 | g14675.t1 | PANTHER | PTHR13946 | DNA-DIRECTED RNA POLYMERASE I,II,III | 14 | 94 | 3.6E-24 |
| 1 | g14675.t1 | Pfam | PF13656 | RNA polymerase Rpb3/Rpb11 dimerisation domain | 21 | 93 | 1.1E-25 |
| 5 | g14675.t1 | ProSitePatterns | PS01154 | RNA polymerases L / 13 to 16 Kd subunits signature. | 25 | 56 | - |
| 4 | g14675.t1 | SUPERFAMILY | SSF55257 | RBP11-like subunits of RNA polymerase | 15 | 93 | 2.75E-26 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003899 | DNA-directed 5’-3’ RNA polymerase activity | MF |
| GO:0003677 | DNA binding | MF |
| GO:0006351 | transcription, DNA-templated | BP |
| GO:0046983 | protein dimerization activity | MF |
KEGG
Orthology
- This transcript has been annotated with K03020 (DNA-directed RNA polymerases I and III subunit RPAC2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
