General information for g15028.t17
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Diacylglycerol O-acyltransferase 1.
Parent gene
- The parent gene g15028 is located on chr_4: 3588891..3590717 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15028 | g15028.t17 | TTS | g15028.t17 | 3587251 | 3587251 |
| chr_4 | g15028 | g15028.t17 | isoform | g15028.t17 | 3588015 | 3588891 |
| chr_4 | g15028 | g15028.t17 | exon | g15028.t17.exon1 | 3588015 | 3588375 |
| chr_4 | g15028 | g15028.t17 | cds | g15028.t17.CDS1 | 3588016 | 3588375 |
| chr_4 | g15028 | g15028.t17 | exon | g15028.t17.exon2 | 3588438 | 3588598 |
| chr_4 | g15028 | g15028.t17 | cds | g15028.t17.CDS2 | 3588438 | 3588503 |
| chr_4 | g15028 | g15028.t17 | exon | g15028.t17.exon3 | 3588696 | 3588752 |
| chr_4 | g15028 | g15028.t17 | exon | g15028.t17.exon4 | 3588818 | 3588891 |
| chr_4 | g15028 | g15028.t17 | TSS | g15028.t17 | NA | NA |
Sequences
>g15028.t17 Gene=g15028 Length=653
AGTACAATGGCTAATTGTACTGAGTGGAAAAAATGAAGGAGATTCATCTTATCCATCGGT
TGTTCTAGCTTTATATTCAAGTGTGCCAATTGTTTTATGTATTATTATTGAAAAAGGACT
TTCTGTGGTAAAAACAACAGGCAAATTTGCACACGTGTTTAACTTGATTGCAGTAGTTCT
TTTGCCAATCGTTGTAATTAATTTACGTGGAACTTCATTTAGTTTGATGGGGTCAACATT
TGTCTGTTTTTTGTACTGTATACTTTTTGTAAAATTATGGAGTTATGTGCAGGTCAATTT
ATGGTGTCGTCAAAATCAAAAGAATCAAAAAGTGTCAATTTCGGGAAAGAGACGAGAAAG
TTTTAGTATAGCAGAATTTGAAAGAAAACATCATAGAAACAGCAATACAGATCAAAATGA
AAATTTTATTGCTAATGATACAAAAGACCATGAACCACTGAAATTGATAGAGTATCCTGA
TAATTTAAATCTTCGTGATCTTATCTATTTTCTTCTTGCGCCAACATTATGTTATGAATT
AAATTTCCCAAGAACAACTCGAATTCGTAAACGGTTTTTAATCAAAAGAATTTTAGAAGT
AGTTGTCGGAGTTAATATTGTCATGGCACTTTTTCAACAATGGATGATACCAA
>g15028.t17 Gene=g15028 Length=142
MGSTFVCFLYCILFVKLWSYVQVNLWCRQNQKNQKVSISGKRRESFSIAEFERKHHRNSN
TDQNENFIANDTKDHEPLKLIEYPDNLNLRDLIYFLLAPTLCYELNFPRTTRIRKRFLIK
RILEVVVGVNIVMALFQQWMIP
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g15028.t17 | PANTHER | PTHR10408:SF7 | DIACYLGLYCEROL O-ACYLTRANSFERASE 1 | 2 | 142 | 1.9E-29 |
| 3 | g15028.t17 | PANTHER | PTHR10408 | STEROL O-ACYLTRANSFERASE | 2 | 142 | 1.9E-29 |
| 1 | g15028.t17 | Pfam | PF03062 | MBOAT, membrane-bound O-acyltransferase family | 5 | 140 | 4.7E-5 |
| 10 | g15028.t17 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 19 | - |
| 11 | g15028.t17 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 12 | g15028.t17 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 15 | - |
| 15 | g15028.t17 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 16 | 19 | - |
| 8 | g15028.t17 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 20 | 91 | - |
| 14 | g15028.t17 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 92 | 110 | - |
| 7 | g15028.t17 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 111 | 121 | - |
| 13 | g15028.t17 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 122 | 141 | - |
| 9 | g15028.t17 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 142 | 142 | - |
| 6 | g15028.t17 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 23 | - |
| 4 | g15028.t17 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 4 | 26 | - |
| 5 | g15028.t17 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 122 | 141 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004144 | diacylglycerol O-acyltransferase activity | MF |
| GO:0019432 | triglyceride biosynthetic process | BP |
| GO:0008374 | O-acyltransferase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed