General information for g15275.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Transmembrane protein 222.
Parent gene
- The parent gene g15275 is located on chr_4: 4777571..4778119 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15275 | g15275.t1 | TTS | g15275.t1 | 4777519 | 4777519 |
| chr_4 | g15275 | g15275.t1 | isoform | g15275.t1 | 4777571 | 4778119 |
| chr_4 | g15275 | g15275.t1 | exon | g15275.t1.exon1 | 4777571 | 4777923 |
| chr_4 | g15275 | g15275.t1 | cds | g15275.t1.CDS1 | 4777571 | 4777923 |
| chr_4 | g15275 | g15275.t1 | exon | g15275.t1.exon2 | 4777975 | 4778119 |
| chr_4 | g15275 | g15275.t1 | cds | g15275.t1.CDS2 | 4777975 | 4778119 |
| chr_4 | g15275 | g15275.t1 | TSS | g15275.t1 | 4778190 | 4778190 |
Sequences
>g15275.t1 Gene=g15275 Length=498
ATGAATGTAACCAAAATTGACTATGATTTACATCGATATCCTTTCTGCTTAGTATGGACA
CCAATACCAATGATTACATGGTTACTTCCTTTTGTTGGTCATATGGGAATTGCAACATCA
CAAGGAATTATCAGAGATTTTGCGGGACCATATTTTGTGAGCGAGGATCAAATGGGTTTT
GGCTGGCCAACACGATATTTACAATTAAATATAGACAAAGTAGAAGGTGGAGCAACATCT
TGGGATGATGCAGTTCAAAAAGCATCAGCTGAATACACAAAGCGAATGCACAATCTTTTT
TGGGATAACTGTCATTCACATTGCGGCATGGCATTGACTATAATGCGATATGGAGGCAGT
AGTTGGTGGAGTATGGTCAAACTTGCTGCTTGGATGTTTTTCTTTGGCAAATATGTTGGT
TTTTGGGGATTTGTCAAAACTTGGCTGCCATTTGCTATAATTTTAACTTTTGCAATTTCT
ATGTGGAAATTTTTGTAA
>g15275.t1 Gene=g15275 Length=165
MNVTKIDYDLHRYPFCLVWTPIPMITWLLPFVGHMGIATSQGIIRDFAGPYFVSEDQMGF
GWPTRYLQLNIDKVEGGATSWDDAVQKASAEYTKRMHNLFWDNCHSHCGMALTIMRYGGS
SWWSMVKLAAWMFFFGKYVGFWGFVKTWLPFAIILTFAISMWKFL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g15275.t1 | PANTHER | PTHR20921:SF0 | TRANSMEMBRANE PROTEIN 222 | 4 | 161 | 2.5E-58 |
| 4 | g15275.t1 | PANTHER | PTHR20921 | UNCHARACTERIZED | 4 | 161 | 2.5E-58 |
| 2 | g15275.t1 | Pfam | PF05608 | Protein of unknown function (DUF778) | 22 | 71 | 3.0E-22 |
| 1 | g15275.t1 | Pfam | PF05608 | Protein of unknown function (DUF778) | 79 | 138 | 5.5E-13 |
| 9 | g15275.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 13 | g15275.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 32 | - |
| 8 | g15275.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 33 | 121 | - |
| 12 | g15275.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 122 | 141 | - |
| 10 | g15275.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 142 | 146 | - |
| 11 | g15275.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 147 | 164 | - |
| 7 | g15275.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 165 | 165 | - |
| 6 | g15275.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 37 | - |
| 5 | g15275.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 138 | 160 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K20726 (transmembrane protein 222)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
