General information for g15788.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Thioredoxin.
Parent gene
- The parent gene g15788 is located on chr_4: 6778535..6781417 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15788 | g15788.t2 | TTS | g15788.t2 | 6778383 | 6778383 |
| chr_4 | g15788 | g15788.t2 | isoform | g15788.t2 | 6778535 | 6778951 |
| chr_4 | g15788 | g15788.t2 | exon | g15788.t2.exon1 | 6778535 | 6778894 |
| chr_4 | g15788 | g15788.t2 | cds | g15788.t2.CDS1 | 6778535 | 6778879 |
| chr_4 | g15788 | g15788.t2 | exon | g15788.t2.exon2 | 6778946 | 6778951 |
| chr_4 | g15788 | g15788.t2 | TSS | g15788.t2 | 6778968 | 6778968 |
Sequences
>g15788.t2 Gene=g15788 Length=366
ATTCGAGATTAAATTAAAATCATGTCAAATATTTTTCACATTGAAGATGAAGAAGATTTT
CAGCAGCAACTTGCAAATGCTGGTGAAAAACTTGTTGTTGTTGATTTTTTTGCAATGTGG
TGTGGTCCATGTCAGAGTGTAAATCCAAAGTTGGAAATTATTGCTGAAAAATATAGTGAA
AAAATTGTTATTTTAAAAATTGATACAGACAAGTGCAGACCATTGAAACTCAAATATGGA
ATTCGTTATGTTCCAACTTTTATTTTCTTCTGGAATGGTGAACGACTAGATGGAATTGTT
GATGAAGCTAATTCCAGAAAAGTTGAAAATTACATTGAAAAATATTTAGCTACAACTCAT
AACTAA
>g15788.t2 Gene=g15788 Length=114
MSNIFHIEDEEDFQQQLANAGEKLVVVDFFAMWCGPCQSVNPKLEIIAEKYSEKIVILKI
DTDKCRPLKLKYGIRYVPTFIFFWNGERLDGIVDEANSRKVENYIEKYLATTHN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g15788.t2 | CDD | cd02947 | TRX_family | 11 | 106 | 7.63686E-28 |
| 8 | g15788.t2 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 2 | 113 | 1.1E-32 |
| 2 | g15788.t2 | PANTHER | PTHR46115 | THIOREDOXIN-LIKE PROTEIN 1 | 1 | 90 | 2.0E-29 |
| 3 | g15788.t2 | PANTHER | PTHR46115:SF1 | THIOREDOXIN-LIKE PROTEIN 1 | 1 | 90 | 2.0E-29 |
| 9 | g15788.t2 | PIRSF | PIRSF000077 | Thioredoxin | 1 | 109 | 6.6E-27 |
| 5 | g15788.t2 | PRINTS | PR00421 | Thioredoxin family signature | 25 | 33 | 7.0E-6 |
| 6 | g15788.t2 | PRINTS | PR00421 | Thioredoxin family signature | 33 | 42 | 7.0E-6 |
| 4 | g15788.t2 | PRINTS | PR00421 | Thioredoxin family signature | 73 | 84 | 7.0E-6 |
| 1 | g15788.t2 | Pfam | PF00085 | Thioredoxin | 9 | 106 | 2.1E-26 |
| 11 | g15788.t2 | ProSitePatterns | PS00194 | Thioredoxin family active site. | 26 | 44 | - |
| 12 | g15788.t2 | ProSiteProfiles | PS51352 | Thioredoxin domain profile. | 1 | 114 | 11.277 |
| 7 | g15788.t2 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 1 | 109 | 9.62E-33 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0015035 | protein-disulfide reductase activity | MF |
| GO:0006662 | glycerol ether metabolic process | BP |
| GO:0045454 | cell redox homeostasis | BP |
KEGG
Orthology
- This transcript has been annotated with K03671 (thioredoxin 1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
