General information for g1584.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Synaptosomal-associated protein 25.
Parent gene
- The parent gene g1584 is located on chr_3: 12008173..12019235 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1584 | g1584.t1 | TTS | g1584.t1 | 12007092 | 12007092 |
| chr_3 | g1584 | g1584.t1 | isoform | g1584.t1 | 12007166 | 12016299 |
| chr_3 | g1584 | g1584.t1 | exon | g1584.t1.exon1 | 12007166 | 12007228 |
| chr_3 | g1584 | g1584.t1 | cds | g1584.t1.CDS1 | 12007166 | 12007228 |
| chr_3 | g1584 | g1584.t1 | exon | g1584.t1.exon2 | 12007759 | 12007903 |
| chr_3 | g1584 | g1584.t1 | cds | g1584.t1.CDS2 | 12007759 | 12007903 |
| chr_3 | g1584 | g1584.t1 | exon | g1584.t1.exon3 | 12007981 | 12008109 |
| chr_3 | g1584 | g1584.t1 | cds | g1584.t1.CDS3 | 12007981 | 12008109 |
| chr_3 | g1584 | g1584.t1 | exon | g1584.t1.exon4 | 12008169 | 12008286 |
| chr_3 | g1584 | g1584.t1 | cds | g1584.t1.CDS4 | 12008169 | 12008286 |
| chr_3 | g1584 | g1584.t1 | exon | g1584.t1.exon5 | 12010908 | 12010956 |
| chr_3 | g1584 | g1584.t1 | cds | g1584.t1.CDS5 | 12010908 | 12010956 |
| chr_3 | g1584 | g1584.t1 | exon | g1584.t1.exon6 | 12016106 | 12016147 |
| chr_3 | g1584 | g1584.t1 | cds | g1584.t1.CDS6 | 12016106 | 12016147 |
| chr_3 | g1584 | g1584.t1 | exon | g1584.t1.exon7 | 12016216 | 12016299 |
| chr_3 | g1584 | g1584.t1 | cds | g1584.t1.CDS7 | 12016216 | 12016299 |
| chr_3 | g1584 | g1584.t1 | TSS | g1584.t1 | NA | NA |
Sequences
>g1584.t1 Gene=g1584 Length=630
ATGCCGGCACCAACTGCAGAACCAGCACCTCCACGAACTGAACTGCAAGAATTGCAATTA
AAGGCACAAGAAAAGACCGATGAGTCTCTTGAGTCAACACGTCGAATGTTGGCACTTTGC
GAAGAGAGTGAAGATGTTGGTGCGAAAACTCTGAATAATTTAGTTAGTCAAGGCGAACAA
TTGGATCGAATTGAGGAGGGTATGGACCAGATTAATGCTGACATGCGTGAAGCTGAAAAA
AATTTGAGTGGAATGGAAAAATGCTGCGGTATTTGTGTTTTGCCATGTAATAAGAGTGCG
TCATTTAAAGAGGATGATGGAACATGGAAGGGTAATGATGATGGAAAAGTTGTAAACAAT
CAGCCACAACGTGTATGTGACGATCGTAATGGTCTTGGACCGCAAGGAGGTTACATTGGA
CGAATCACAAATGATGCACGTGAAGATGAGATGGAAGAGAATATGGGTCAAGTGAACACA
ATGATTGGTAATTTAAGAAATATGGCACTCGATATGGGTTCAGAGCTCGAAAATCAGAAT
CGTCAAATTGATAGAATCAATCGCAAGGGTGAATCAAATGAGACGAGGATAGCGGTGGCC
AACGAAAGAGCACATGATTTGCTCAAATAA
>g1584.t1 Gene=g1584 Length=209
MPAPTAEPAPPRTELQELQLKAQEKTDESLESTRRMLALCEESEDVGAKTLNNLVSQGEQ
LDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSASFKEDDGTWKGNDDGKVVNN
QPQRVCDDRNGLGPQGGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQN
RQIDRINRKGESNETRIAVANERAHDLLK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g1584.t1 | CDD | cd15889 | SNARE_SNAP25N_23N | 20 | 84 | 5.48747E-28 |
| 11 | g1584.t1 | CDD | cd15885 | SNARE_SNAP25C | 148 | 206 | 1.76598E-30 |
| 8 | g1584.t1 | Coils | Coil | Coil | 61 | 88 | - |
| 9 | g1584.t1 | Coils | Coil | Coil | 169 | 189 | - |
| 6 | g1584.t1 | Gene3D | G3DSA:1.20.5.110 | - | 5 | 85 | 1.1E-35 |
| 7 | g1584.t1 | Gene3D | G3DSA:1.20.5.110 | - | 125 | 209 | 1.5E-31 |
| 14 | g1584.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 29 | - |
| 2 | g1584.t1 | PANTHER | PTHR19305:SF14 | SYNAPTOSOMAL-ASSOCIATED PROTEIN-RELATED | 9 | 209 | 4.1E-86 |
| 3 | g1584.t1 | PANTHER | PTHR19305 | SYNAPTOSOMAL ASSOCIATED PROTEIN | 9 | 209 | 4.1E-86 |
| 1 | g1584.t1 | Pfam | PF00835 | SNAP-25 family | 95 | 146 | 1.1E-20 |
| 16 | g1584.t1 | ProSiteProfiles | PS50192 | t-SNARE coiled-coil homology domain profile. | 23 | 85 | 12.598 |
| 15 | g1584.t1 | ProSiteProfiles | PS50192 | t-SNARE coiled-coil homology domain profile. | 145 | 207 | 17.599 |
| 13 | g1584.t1 | SMART | SM00397 | tSNARE_6 | 18 | 85 | 3.2E-11 |
| 12 | g1584.t1 | SMART | SM00397 | tSNARE_6 | 140 | 207 | 2.3E-14 |
| 4 | g1584.t1 | SUPERFAMILY | SSF58038 | SNARE fusion complex | 13 | 83 | 1.83E-21 |
| 5 | g1584.t1 | SUPERFAMILY | SSF58038 | SNARE fusion complex | 135 | 208 | 7.52E-18 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K18211 (synaptosomal-associated protein 25)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
