General information for g16094.t22
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Aldehyde dehydrogenase family 3 member A2.
Parent gene
- The parent gene g16094 is located on chr_4: 8135015..8141389 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16094 | g16094.t22 | isoform | g16094.t22 | 8133754 | 8135379 |
| chr_4 | g16094 | g16094.t22 | exon | g16094.t22.exon1 | 8133754 | 8133942 |
| chr_4 | g16094 | g16094.t22 | cds | g16094.t22.CDS1 | 8133860 | 8133942 |
| chr_4 | g16094 | g16094.t22 | exon | g16094.t22.exon2 | 8133997 | 8134121 |
| chr_4 | g16094 | g16094.t22 | cds | g16094.t22.CDS2 | 8133997 | 8134121 |
| chr_4 | g16094 | g16094.t22 | exon | g16094.t22.exon3 | 8134905 | 8134953 |
| chr_4 | g16094 | g16094.t22 | cds | g16094.t22.CDS3 | 8134905 | 8134953 |
| chr_4 | g16094 | g16094.t22 | exon | g16094.t22.exon4 | 8135015 | 8135092 |
| chr_4 | g16094 | g16094.t22 | cds | g16094.t22.CDS4 | 8135015 | 8135092 |
| chr_4 | g16094 | g16094.t22 | exon | g16094.t22.exon5 | 8135147 | 8135300 |
| chr_4 | g16094 | g16094.t22 | cds | g16094.t22.CDS5 | 8135147 | 8135300 |
| chr_4 | g16094 | g16094.t22 | exon | g16094.t22.exon6 | 8135368 | 8135379 |
| chr_4 | g16094 | g16094.t22 | cds | g16094.t22.CDS6 | 8135368 | 8135379 |
| chr_4 | g16094 | g16094.t22 | TTS | g16094.t22 | 8135519 | 8135519 |
| chr_4 | g16094 | g16094.t22 | TSS | g16094.t22 | NA | NA |
Sequences
>g16094.t22 Gene=g16094 Length=607
AAAGCTATTGAGCAGTGGAACAATTGCCGTTGGTGGTAAAACCGATGCAGATGAAAGATT
TATCGAACCAACAATCATTGTTGATGCAAAATCAACTGATGCTGTCATGCAAGAAGAAAT
TTTTGGTCCCATTTTACCTATTGTTAATATCAATAATGCATTTGAAGCCATAAAATTCAT
CACAGCAAGAGATAAACCATTGGCACTTTATATATTTTCAAACAACACAAATGATCGTCA
AACAATTATTGAAAATACGTCATCAGGTGGTGTTTGTGTCAATGACACTATTATGCATCT
TGCTGTTGATACAATGCCTTTTGGTGGTGTTGGACCAAGTGGTATGGGAGGTTATCATGG
AAAGTACTCATTTGATACATTTTCGCATAAAAAATCTTGCTTGGTAAAGAAAATTGACAC
AATCAGTGAGAAACTGTCAAATGCACGCTATCCACCATATAGTGACAAAAAGATCAACTA
TTTGACTTTTCTTACTAAAAAACGTAAAGGCTTTTCAATTCCTTACTTACCACAGTTAGT
TTTGCTTGGAGTTGGTGTTGCTGCAACGATTTTCGTTCAACGCATTTTGCCTGAATGTGA
ACAGTAG
>g16094.t22 Gene=g16094 Length=166
MQEEIFGPILPIVNINNAFEAIKFITARDKPLALYIFSNNTNDRQTIIENTSSGGVCVND
TIMHLAVDTMPFGGVGPSGMGGYHGKYSFDTFSHKKSCLVKKIDTISEKLSNARYPPYSD
KKINYLTFLTKKRKGFSIPYLPQLVLLGVGVAATIFVQRILPECEQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g16094.t22 | Gene3D | G3DSA:3.40.309.10 | Aldehyde Dehydrogenase; Chain A | 1 | 107 | 6.3E-31 |
| 2 | g16094.t22 | PANTHER | PTHR43570:SF29 | ALDEHYDE DEHYDROGENASE TYPE III, ISOFORM Q | 1 | 161 | 3.3E-69 |
| 3 | g16094.t22 | PANTHER | PTHR43570 | ALDEHYDE DEHYDROGENASE | 1 | 161 | 3.3E-69 |
| 1 | g16094.t22 | Pfam | PF00171 | Aldehyde dehydrogenase family | 1 | 97 | 3.9E-17 |
| 7 | g16094.t22 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 139 | - |
| 9 | g16094.t22 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 140 | 161 | - |
| 8 | g16094.t22 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 162 | 166 | - |
| 5 | g16094.t22 | SUPERFAMILY | SSF53720 | ALDH-like | 1 | 101 | 9.56E-29 |
| 4 | g16094.t22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 135 | 157 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016620 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
