General information for g16419.t32
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Glutathione S-transferase.
Parent gene
- The parent gene g16419 is located on chr_4: 9395242..9398308 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g16419 | g16419.t32 | TTS | g16419.t32 | 9392821 | 9392821 |
| chr_4 | g16419 | g16419.t32 | isoform | g16419.t32 | 9392882 | 9395632 |
| chr_4 | g16419 | g16419.t32 | exon | g16419.t32.exon1 | 9392882 | 9393033 |
| chr_4 | g16419 | g16419.t32 | cds | g16419.t32.CDS1 | 9392982 | 9393033 |
| chr_4 | g16419 | g16419.t32 | exon | g16419.t32.exon2 | 9394145 | 9394307 |
| chr_4 | g16419 | g16419.t32 | cds | g16419.t32.CDS2 | 9394145 | 9394307 |
| chr_4 | g16419 | g16419.t32 | exon | g16419.t32.exon3 | 9395500 | 9395632 |
| chr_4 | g16419 | g16419.t32 | cds | g16419.t32.CDS3 | 9395500 | 9395632 |
| chr_4 | g16419 | g16419.t32 | TSS | g16419.t32 | 9395732 | 9395732 |
Sequences
>g16419.t32 Gene=g16419 Length=448
ATGGTGGTTTACAAATTACATTATTTTAATTTAACTGGTTTGGGTGAACCGATTCGATTT
TTATTCCATTATGGTGGAATTGATTTTGAAGATGTGAGGTATGAAATGAATGAATGGGTC
GATCTTAAAAAAAAATTCCCTCTTGGTCAATTACCAGTCTTAGAAATAGACGACAAAGAG
CATGTTCAATCAATGGCAATTTGTCGCTATTTAGCAAAACAAGTCGGTCTTGCTGGAGAC
AGTGACCTTGAAAACATGGAAATTGATGCGGTTGTTGATACTTTCAATGATATTCGTCGC
ATCTTGGTCAAAGTATTTCTCTTATGCCATCAAAGAAGTCTTCAATGATTATGAAAACTA
TCCAAACATTAAGAAAGTTGTCGACAATGTTTTAGCAATTGAAAACATTAAAAAATGGGT
TGAAACAAGACCCGACACATTCTGTTGA
>g16419.t32 Gene=g16419 Length=115
MVVYKLHYFNLTGLGEPIRFLFHYGGIDFEDVRYEMNEWVDLKKKFPLGQLPVLEIDDKE
HVQSMAICRYLAKQVGLAGDSDLENMEIDAVVDTFNDIRRILVKVFLLCHQRSLQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g16419.t32 | CDD | cd03039 | GST_N_Sigma_like | 4 | 73 | 0.000 |
| 6 | g16419.t32 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 4 | 75 | 0.000 |
| 5 | g16419.t32 | Gene3D | G3DSA:1.20.1050.10 | - | 76 | 106 | 0.000 |
| 2 | g16419.t32 | PANTHER | PTHR11571:SF234 | GLUTATHIONE S-TRANSFERASE S1 | 3 | 104 | 0.000 |
| 3 | g16419.t32 | PANTHER | PTHR11571 | GLUTATHIONE S-TRANSFERASE | 3 | 104 | 0.000 |
| 1 | g16419.t32 | Pfam | PF02798 | Glutathione S-transferase, N-terminal domain | 5 | 72 | 0.000 |
| 7 | g16419.t32 | ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 2 | 79 | 28.303 |
| 9 | g16419.t32 | SFLD | SFLDG01205 | AMPS.1 | 1 | 107 | 0.000 |
| 10 | g16419.t32 | SFLD | SFLDS00019 | Glutathione Transferase (cytosolic) | 1 | 107 | 0.000 |
| 4 | g16419.t32 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 1 | 75 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006749 | glutathione metabolic process | BP |
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed