General information for g1720.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Glutathione S-transferase 1-1.
Parent gene
- The parent gene g1720 is located on chr_3: 12744397..12745103 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1720 | g1720.t1 | TTS | g1720.t1 | 12744294 | 12744294 |
| chr_3 | g1720 | g1720.t1 | isoform | g1720.t1 | 12744397 | 12745103 |
| chr_3 | g1720 | g1720.t1 | exon | g1720.t1.exon1 | 12744397 | 12745001 |
| chr_3 | g1720 | g1720.t1 | cds | g1720.t1.CDS1 | 12744397 | 12745001 |
| chr_3 | g1720 | g1720.t1 | exon | g1720.t1.exon2 | 12745061 | 12745103 |
| chr_3 | g1720 | g1720.t1 | cds | g1720.t1.CDS2 | 12745061 | 12745103 |
| chr_3 | g1720 | g1720.t1 | TSS | g1720.t1 | 12745205 | 12745205 |
Sequences
>g1720.t1 Gene=g1720 Length=648
ATGTCAAAAAGTGATAGACGCCCAGTGCTTTATTATACATTAGCTTCAGCTTCGTGTCGT
TCAGTCCTCATGACGGCAGAAGCATTGAAGCTTAAATTAAATTTAAAACCAATGGATTTA
ATGCAAAGAGAGCATTTACATCCGGGATTTTTAAAAATAAATCCTCATCATCAAGTACCA
ACTCTATCTGACAATGAATTTAATTTGTATGAGTCGAGAGCAATTTGCATCTATTTAGTC
GAGAAATATGGTAAAAATGATTCTCTGTATCCGAAGAACCCAAAATTGAGAGCAAAAATT
AACCAATTGATCTATTTTGATCTCGGCACTTTGTACAAAAGTTTTTATGAGTATATCGTT
CCTGTATTTATGGGAGAAGAGTTGAGCGATGAAAAGTTAAAACCATTGCAAGAAGCTGTT
CAATTTTTAGATGGATTTTTGTCTGATAAAAAATTTGCAGTTGCTTACAAAATCACGATT
GCTGATTTAATTTTACTTGCTAGTGTTTCATCGATCGAAGCTTTTGACTTTGATTTCTCA
TCTTATCCAAATGTCACCAACTGGCTTGAAAATATGAAAGAGTGTGCTCCTGGCTATGAT
TTAAATCAAGAGGGAATAGAAATGTTCAAATCATTCATGAAAAAGTAA
>g1720.t1 Gene=g1720 Length=215
MSKSDRRPVLYYTLASASCRSVLMTAEALKLKLNLKPMDLMQREHLHPGFLKINPHHQVP
TLSDNEFNLYESRAICIYLVEKYGKNDSLYPKNPKLRAKINQLIYFDLGTLYKSFYEYIV
PVFMGEELSDEKLKPLQEAVQFLDGFLSDKKFAVAYKITIADLILLASVSSIEAFDFDFS
SYPNVTNWLENMKECAPGYDLNQEGIEMFKSFMKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 15 | g1720.t1 | CDD | cd03045 | GST_N_Delta_Epsilon | 8 | 81 | 1.79543E-36 |
| 14 | g1720.t1 | CDD | cd03177 | GST_C_Delta_Epsilon | 95 | 210 | 8.58107E-47 |
| 8 | g1720.t1 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 5 | 84 | 5.0E-25 |
| 7 | g1720.t1 | Gene3D | G3DSA:1.20.1050.10 | - | 85 | 215 | 4.1E-45 |
| 3 | g1720.t1 | PANTHER | PTHR43969:SF9 | GLUTATHIONE S TRANSFERASE D10, ISOFORM A-RELATED | 9 | 214 | 2.2E-72 |
| 4 | g1720.t1 | PANTHER | PTHR43969 | GLUTATHIONE S TRANSFERASE D10, ISOFORM A-RELATED | 9 | 214 | 2.2E-72 |
| 2 | g1720.t1 | Pfam | PF13417 | Glutathione S-transferase, N-terminal domain | 10 | 85 | 2.6E-12 |
| 1 | g1720.t1 | Pfam | PF00043 | Glutathione S-transferase, C-terminal domain | 125 | 192 | 2.1E-9 |
| 10 | g1720.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 28 | - |
| 11 | g1720.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 8 | - |
| 12 | g1720.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 9 | 19 | - |
| 13 | g1720.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 20 | 28 | - |
| 9 | g1720.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 29 | 215 | - |
| 17 | g1720.t1 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. | 1 | 19 | 7.0 |
| 18 | g1720.t1 | ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 6 | 87 | 20.959 |
| 16 | g1720.t1 | ProSiteProfiles | PS50405 | Soluble glutathione S-transferase C-terminal domain profile. | 93 | 215 | 18.761 |
| 19 | g1720.t1 | SFLD | SFLDG01153 | Main.4: Theta-like | 8 | 215 | 0.0 |
| 20 | g1720.t1 | SFLD | SFLDS00019 | Glutathione Transferase (cytosolic) | 8 | 215 | 0.0 |
| 5 | g1720.t1 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 7 | 92 | 9.16E-24 |
| 6 | g1720.t1 | SUPERFAMILY | SSF47616 | GST C-terminal domain-like | 78 | 194 | 1.81E-24 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006749 | glutathione metabolic process | BP |
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed