General information for g17829.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Probable cytochrome P450 313a4.
Parent gene
- The parent gene g17829 is located on HiC_scaffold_385: 14470..14937 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| HiC_scaffold_385 | g17829 | g17829.t1 | isoform | g17829.t1 | 14470 | 14937 |
| HiC_scaffold_385 | g17829 | g17829.t1 | exon | g17829.t1.exon1 | 14470 | 14653 |
| HiC_scaffold_385 | g17829 | g17829.t1 | cds | g17829.t1.CDS1 | 14470 | 14653 |
| HiC_scaffold_385 | g17829 | g17829.t1 | exon | g17829.t1.exon2 | 14765 | 14937 |
| HiC_scaffold_385 | g17829 | g17829.t1 | cds | g17829.t1.CDS2 | 14765 | 14937 |
| HiC_scaffold_385 | g17829 | g17829.t1 | TSS | g17829.t1 | NA | NA |
| HiC_scaffold_385 | g17829 | g17829.t1 | TTS | g17829.t1 | NA | NA |
Sequences
>g17829.t1 Gene=g17829 Length=357
ATGTTTCCAGAAGTTGAAAGAAAAGTTTATGAGGAAATAATGCAAAACTGCCCAAATAAT
GACATTGATATGAAAACTATTAGAAATTTGAAATATTTAGAATGTGTCATGAATGAAAGT
ATGAGATTATTTCCAATTAATTTAACTTATGTAAGAAAAGTTGAAAAAGATTTGAAACTT
GATGACAATATAATTTTACCACGAAATTCCTATGCTTTTATTCGTACAAAAGATGTTCAT
CGTGATCCAACAATATGGGGTGATGACGCCAATGAATTCAAACCTGAAAGATTCTTGCCA
GAAAATATCAAAAAAGTTCATCCCTTTGCTTTTCATCCGTTTGTTCTTGGACCTTGA
>g17829.t1 Gene=g17829 Length=118
MFPEVERKVYEEIMQNCPNNDIDMKTIRNLKYLECVMNESMRLFPINLTYVRKVEKDLKL
DDNIILPRNSYAFIRTKDVHRDPTIWGDDANEFKPERFLPENIKKVHPFAFHPFVLGP
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g17829.t1 | Gene3D | G3DSA:1.10.630.10 | Cytochrome p450 | 1 | 118 | 0 |
| 2 | g17829.t1 | PANTHER | PTHR24291:SF105 | CYTOCHROME P450 4P1-RELATED | 3 | 118 | 0 |
| 3 | g17829.t1 | PANTHER | PTHR24291 | CYTOCHROME P450 FAMILY 4 | 3 | 118 | 0 |
| 1 | g17829.t1 | Pfam | PF00067 | Cytochrome P450 | 3 | 118 | 0 |
| 4 | g17829.t1 | SUPERFAMILY | SSF48264 | Cytochrome P450 | 2 | 118 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0020037 | heme binding | MF |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | MF |
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed