General information for g1995.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Somatostatin receptor type 1.
Parent gene
- The parent gene g1995 is located on chr_3: 14323832..14326587 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1995 | g1995.t1 | isoform | g1995.t1 | 14323832 | 14326587 |
| chr_3 | g1995 | g1995.t1 | exon | g1995.t1.exon1 | 14323832 | 14324309 |
| chr_3 | g1995 | g1995.t1 | cds | g1995.t1.CDS1 | 14323832 | 14324309 |
| chr_3 | g1995 | g1995.t1 | exon | g1995.t1.exon2 | 14324376 | 14324464 |
| chr_3 | g1995 | g1995.t1 | cds | g1995.t1.CDS2 | 14324376 | 14324464 |
| chr_3 | g1995 | g1995.t1 | exon | g1995.t1.exon3 | 14325325 | 14325766 |
| chr_3 | g1995 | g1995.t1 | cds | g1995.t1.CDS3 | 14325325 | 14325766 |
| chr_3 | g1995 | g1995.t1 | exon | g1995.t1.exon4 | 14326051 | 14326260 |
| chr_3 | g1995 | g1995.t1 | cds | g1995.t1.CDS4 | 14326051 | 14326260 |
| chr_3 | g1995 | g1995.t1 | exon | g1995.t1.exon5 | 14326328 | 14326587 |
| chr_3 | g1995 | g1995.t1 | cds | g1995.t1.CDS5 | 14326328 | 14326587 |
| chr_3 | g1995 | g1995.t1 | TSS | g1995.t1 | NA | NA |
| chr_3 | g1995 | g1995.t1 | TTS | g1995.t1 | NA | NA |
Sequences
>g1995.t1 Gene=g1995 Length=1479
ATGAATACGTTCGAAGATTCAGCAACGAGGTCATTTTTTTATGATGGTCCCTCATTTGAT
TTTTTGATGTCATCAGACTTTCCAAACACATCATCTATAACTTATCAAAATAACGATCCG
CATGGAAATGAAACAATGTTCATGAGCTGCCATTCAGGCGGACCCAATAATCTTGGTCGT
TACATATCGATGATACTATTCACAGTTGTGTGCATTGTTGGACTTTTTGGAAATAGTTTA
GTGATATATGTTGTATTACGATTCAGCAAAATGAAAACGGTAACAAATTTGTACATTCTG
AATCTCGCGTTGGCTGATGAATTTTTTTTGATTGGAGTTCCGACACTCATTTACACTATG
CAAGTGGGTGAATGGATTTTTGGGGAGCAGCTTTGTAAACTATATATGATATCGACGAGC
ATAACACAATTTACATCATCAATTTTCCTAGTCATCATGTCGGCTGATAGATTTATTGCT
GTTTGTCATCCAATTTCCTCGCCTCGCTTTCGCACACCACTAGTTTCAAAAATTGTCTCG
TTGATTGCATGGTGCTTATCCGTTATCATGATGCTTCCAATCATCCTCTATTCAACAACA
ATTCCTCGACCTGATGGTAAAAAGACTTGTAATATTGTATGGCCTACGAGCAATACACGA
TCAAATGGAACATCATCAGAGGAAGATGGCTTAATTGAGCCAAATGGATCAACATTTACT
CTATATACCTTCACAATGGGTTTCGCAATTCCACTCTGTCTTATCCTGATCTTCTATTAT
CTAGTTTTGCGTAAACTTAGAACAGTTGGACCGAAAACAAAGTCAAAGGAAAAGAAGAGA
TCACATCGTAAAGTAACGAAGCTTGTTCTGACTGTCATTGCTGTGTATATCCTTTGTTGG
ACCCCATACTGGGTTAGTCAAATGGCATTAATAAATTCATCGCCTGAGGTCTGCCAGTCA
AAGTTAGAAATCACAATTTTCATTCTTGTCGGCTGTTTAGGCTATTCAAACTCTAGTATG
AATCCAGTGCTCTACGCTTTTCTATCAGATAATTTTAAGAAATCATTTATGAAGGCATTC
ACTTGTGCCAAGACCAAAGAAATCAATGCACAATTGCAAGCTGAAAACAGCTTCTTTCCA
CGATTTGGTCGTAATCGCAATTCAGAATGCATTTCATCGAAACCAACAACCAATCTTATT
GTGAATGCGAATTCACAAATTACATCAACTAAACTTGCATCAACAAAACTCGGTAATACA
GTTGAGTCGATATTAGATGCGACTGAGAATGGACATACAACAACAGCAACAAATGGACAT
CAATTGAATAACATCAACAAGCTCTGCATCAAAACAAGTGATGAGGAAAGCGATGACGAA
CAAGAGATGCAGGACAAGCACGATGAATCCATTTGCATAATAAATCCTAGTAATGGAACA
CATCATAGTAAACCACCAGTATTACACACAGATCTATAA
>g1995.t1 Gene=g1995 Length=492
MNTFEDSATRSFFYDGPSFDFLMSSDFPNTSSITYQNNDPHGNETMFMSCHSGGPNNLGR
YISMILFTVVCIVGLFGNSLVIYVVLRFSKMKTVTNLYILNLALADEFFLIGVPTLIYTM
QVGEWIFGEQLCKLYMISTSITQFTSSIFLVIMSADRFIAVCHPISSPRFRTPLVSKIVS
LIAWCLSVIMMLPIILYSTTIPRPDGKKTCNIVWPTSNTRSNGTSSEEDGLIEPNGSTFT
LYTFTMGFAIPLCLILIFYYLVLRKLRTVGPKTKSKEKKRSHRKVTKLVLTVIAVYILCW
TPYWVSQMALINSSPEVCQSKLEITIFILVGCLGYSNSSMNPVLYAFLSDNFKKSFMKAF
TCAKTKEINAQLQAENSFFPRFGRNRNSECISSKPTTNLIVNANSQITSTKLASTKLGNT
VESILDATENGHTTTATNGHQLNNINKLCIKTSDEESDDEQEMQDKHDESICIINPSNGT
HHSKPPVLHTDL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 32 | g1995.t1 | CDD | cd15094 | 7tmA_AstC_insect | 62 | 356 | 4.76271E-145 |
| 16 | g1995.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 33 | 378 | 1.9E-81 |
| 2 | g1995.t1 | PANTHER | PTHR24229:SF51 | ALLATOSTATIN C RECEPTOR 1-RELATED | 31 | 389 | 1.7E-142 |
| 3 | g1995.t1 | PANTHER | PTHR24229 | NEUROPEPTIDES RECEPTOR | 31 | 389 | 1.7E-142 |
| 14 | g1995.t1 | PRINTS | PR00246 | Somatostatin receptor signature | 59 | 71 | 8.7E-8 |
| 7 | g1995.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 62 | 86 | 1.9E-46 |
| 4 | g1995.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 95 | 116 | 1.9E-46 |
| 10 | g1995.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 139 | 161 | 1.9E-46 |
| 5 | g1995.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 175 | 196 | 1.9E-46 |
| 9 | g1995.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 240 | 263 | 1.9E-46 |
| 11 | g1995.t1 | PRINTS | PR00246 | Somatostatin receptor signature | 264 | 273 | 8.7E-8 |
| 12 | g1995.t1 | PRINTS | PR00246 | Somatostatin receptor signature | 274 | 287 | 8.7E-8 |
| 6 | g1995.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 285 | 309 | 1.9E-46 |
| 8 | g1995.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 327 | 353 | 1.9E-46 |
| 13 | g1995.t1 | PRINTS | PR00246 | Somatostatin receptor signature | 347 | 359 | 8.7E-8 |
| 1 | g1995.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 77 | 345 | 1.2E-52 |
| 23 | g1995.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 60 | - |
| 29 | g1995.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 86 | - |
| 18 | g1995.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 87 | 97 | - |
| 30 | g1995.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 98 | 122 | - |
| 22 | g1995.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 123 | 133 | - |
| 25 | g1995.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 153 | - |
| 17 | g1995.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 154 | 173 | - |
| 31 | g1995.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 174 | 197 | - |
| 21 | g1995.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 198 | 238 | - |
| 28 | g1995.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 239 | 263 | - |
| 19 | g1995.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 264 | 283 | - |
| 27 | g1995.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 284 | 304 | - |
| 24 | g1995.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 305 | 323 | - |
| 26 | g1995.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 324 | 348 | - |
| 20 | g1995.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 349 | 492 | - |
| 41 | g1995.t1 | ProSitePatterns | PS00237 | G-protein coupled receptors family 1 signature. | 145 | 161 | - |
| 42 | g1995.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 77 | 345 | 44.585 |
| 40 | g1995.t1 | SMART | SM01381 | 7TM_GPCR_Srsx_2 | 71 | 360 | 1.1E-5 |
| 15 | g1995.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 24 | 367 | 3.94E-70 |
| 37 | g1995.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 84 | - |
| 35 | g1995.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 97 | 119 | - |
| 33 | g1995.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 153 | - |
| 36 | g1995.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 174 | 196 | - |
| 38 | g1995.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 241 | 263 | - |
| 34 | g1995.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 289 | 311 | - |
| 39 | g1995.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 326 | 348 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004994 | somatostatin receptor activity | MF |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K22872 (allatostatin C receptor)
Pathway
This gene does not belong to any pathways.
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed