General information for g2233.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as V-type proton ATPase subunit F 1.
Parent gene
- The parent gene g2233 is located on chr_3: 16189899..16192137 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2233 | g2233.t3 | TSS | g2233.t3 | 16189525 | 16189525 |
| chr_3 | g2233 | g2233.t3 | isoform | g2233.t3 | 16189612 | 16190205 |
| chr_3 | g2233 | g2233.t3 | exon | g2233.t3.exon1 | 16189612 | 16189665 |
| chr_3 | g2233 | g2233.t3 | cds | g2233.t3.CDS1 | 16189612 | 16189665 |
| chr_3 | g2233 | g2233.t3 | exon | g2233.t3.exon2 | 16189754 | 16189835 |
| chr_3 | g2233 | g2233.t3 | cds | g2233.t3.CDS2 | 16189754 | 16189835 |
| chr_3 | g2233 | g2233.t3 | exon | g2233.t3.exon3 | 16189899 | 16190057 |
| chr_3 | g2233 | g2233.t3 | cds | g2233.t3.CDS3 | 16189899 | 16190057 |
| chr_3 | g2233 | g2233.t3 | exon | g2233.t3.exon4 | 16190153 | 16190205 |
| chr_3 | g2233 | g2233.t3 | cds | g2233.t3.CDS4 | 16190153 | 16190205 |
| chr_3 | g2233 | g2233.t3 | TTS | g2233.t3 | 16190420 | 16190420 |
Sequences
>g2233.t3 Gene=g2233 Length=348
ATGGCTCTTCATTCAGCAATCAAAGGAAAACTTCTGTCAGTCATTGGCGATGAGGACACT
TGCGTTGGATTTTTACTCGGTGGAGTTGGTGAAATCAACAAGAACCGTCATCCAAACTTT
ATGGTTGTTGATAAGAACACTGCCGTGAGTGAAATTGAAGATTGCTTTAAGAGATTTGTT
AAACGCGATGATATTGACATCATTCTTATTAATCAAAATTGTGCTGAATTAATTCGTCAT
GTTATTGATGCTCATACATCACCAGTTCCAGCTATTCTTGAAATCCCATCAAAAGACTCA
ATTCTTAGACGAGCAAAGGGAATGTTCTCAGCTGAAGATTTAAAATAA
>g2233.t3 Gene=g2233 Length=115
MALHSAIKGKLLSVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSEIEDCFKRFV
KRDDIDIILINQNCAELIRHVIDAHTSPVPAILEIPSKDSILRRAKGMFSAEDLK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g2233.t3 | Gene3D | G3DSA:3.40.50.10580 | - | 6 | 111 | 0 |
| 2 | g2233.t3 | PANTHER | PTHR13861:SF2 | V-TYPE PROTON ATPASE SUBUNIT F | 9 | 114 | 0 |
| 3 | g2233.t3 | PANTHER | PTHR13861 | VACUOLAR ATP SYNTHASE SUBUNIT F | 9 | 114 | 0 |
| 7 | g2233.t3 | PIRSF | PIRSF015945 | V-ATP_synth_F | 1 | 112 | 0 |
| 1 | g2233.t3 | Pfam | PF01990 | ATP synthase (F/14-kDa) subunit | 13 | 103 | 0 |
| 4 | g2233.t3 | SUPERFAMILY | SSF159468 | AtpF-like | 13 | 96 | 0 |
| 6 | g2233.t3 | TIGRFAM | TIGR01101 | V_ATP_synt_F: V-type ATPase, F subunit | 3 | 114 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:1902600 | proton transmembrane transport | BP |
| GO:0034220 | ion transmembrane transport | BP |
| GO:0033180 | proton-transporting V-type ATPase, V1 domain | CC |
| GO:0046961 | proton-transporting ATPase activity, rotational mechanism | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed