Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g2440 g2440.t1 TTS g2440.t1 18007339 18007339
chr_3 g2440 g2440.t1 isoform g2440.t1 18007386 18007696
chr_3 g2440 g2440.t1 exon g2440.t1.exon1 18007386 18007582
chr_3 g2440 g2440.t1 cds g2440.t1.CDS1 18007386 18007582
chr_3 g2440 g2440.t1 exon g2440.t1.exon2 18007639 18007696
chr_3 g2440 g2440.t1 cds g2440.t1.CDS2 18007639 18007696
chr_3 g2440 g2440.t1 TSS g2440.t1 NA NA

Sequences

>g2440.t1 Gene=g2440 Length=255
ATGACTGGCCGTGGCAAAGGAGGCAAAGGTTTAGGAAAAGGAGGTGCAAAGCGTCATCCT
CGTCGTGTGGGTGTCAAGCGTATTTCAGGCTTGATCTACGAAGAAACTCGTGGTGTCTTG
AAAGTATTCTTGGAAAATGTCATTCGTGATGCAGTCACATACACTGAACACGCAAAGCGC
AAGACAGTCACAGCTATGGATGTTGTTTATGCTTTGAAACGTCAAGGACGTACTCTCTAT
GGTTTCGGAGGTTAA

>g2440.t1 Gene=g2440 Length=84
MTGRGKGGKGLGKGGAKRHPRRVGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKR
KTVTAMDVVYALKRQGRTLYGFGG

Protein features from InterProScan

Transcript Database ID Name Start End E.value
10 g2440.t1 Gene3D G3DSA:1.10.20.10 Histone 9 84 9.9E-37
9 g2440.t1 MobiDBLite mobidb-lite consensus disorder prediction 1 22 -
2 g2440.t1 PANTHER PTHR10484 HISTONE H4 1 20 3.4E-43
4 g2440.t1 PANTHER PTHR10484:SF185 HISTONE H4 1 20 3.4E-43
3 g2440.t1 PANTHER PTHR10484 HISTONE H4 21 84 3.4E-43
5 g2440.t1 PANTHER PTHR10484:SF185 HISTONE H4 21 84 3.4E-43
1 g2440.t1 Pfam PF15511 Centromere kinetochore component CENP-T histone fold 35 77 6.8E-8
8 g2440.t1 ProSitePatterns PS00047 Histone H4 signature. 15 19 -
7 g2440.t1 SMART SM00417 h44 17 71 4.8E-24
6 g2440.t1 SUPERFAMILY SSF47113 Histone-fold 4 83 1.86E-21

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0003677 DNA binding MF
GO:0046982 protein heterodimerization activity MF
GO:0000786 nucleosome CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed