Chromosome | Gene | Transcript | Category | ID | Start | End |
---|---|---|---|---|---|---|
chr_3 | g2440 | g2440.t1 | TTS | g2440.t1 | 18007339 | 18007339 |
chr_3 | g2440 | g2440.t1 | isoform | g2440.t1 | 18007386 | 18007696 |
chr_3 | g2440 | g2440.t1 | exon | g2440.t1.exon1 | 18007386 | 18007582 |
chr_3 | g2440 | g2440.t1 | cds | g2440.t1.CDS1 | 18007386 | 18007582 |
chr_3 | g2440 | g2440.t1 | exon | g2440.t1.exon2 | 18007639 | 18007696 |
chr_3 | g2440 | g2440.t1 | cds | g2440.t1.CDS2 | 18007639 | 18007696 |
chr_3 | g2440 | g2440.t1 | TSS | g2440.t1 | NA | NA |
>g2440.t1 Gene=g2440 Length=255
ATGACTGGCCGTGGCAAAGGAGGCAAAGGTTTAGGAAAAGGAGGTGCAAAGCGTCATCCT
CGTCGTGTGGGTGTCAAGCGTATTTCAGGCTTGATCTACGAAGAAACTCGTGGTGTCTTG
AAAGTATTCTTGGAAAATGTCATTCGTGATGCAGTCACATACACTGAACACGCAAAGCGC
AAGACAGTCACAGCTATGGATGTTGTTTATGCTTTGAAACGTCAAGGACGTACTCTCTAT
GGTTTCGGAGGTTAA
>g2440.t1 Gene=g2440 Length=84
MTGRGKGGKGLGKGGAKRHPRRVGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKR
KTVTAMDVVYALKRQGRTLYGFGG
Transcript | Database | ID | Name | Start | End | E.value | |
---|---|---|---|---|---|---|---|
10 | g2440.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 9 | 84 | 9.9E-37 |
9 | g2440.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 22 | - |
2 | g2440.t1 | PANTHER | PTHR10484 | HISTONE H4 | 1 | 20 | 3.4E-43 |
4 | g2440.t1 | PANTHER | PTHR10484:SF185 | HISTONE H4 | 1 | 20 | 3.4E-43 |
3 | g2440.t1 | PANTHER | PTHR10484 | HISTONE H4 | 21 | 84 | 3.4E-43 |
5 | g2440.t1 | PANTHER | PTHR10484:SF185 | HISTONE H4 | 21 | 84 | 3.4E-43 |
1 | g2440.t1 | Pfam | PF15511 | Centromere kinetochore component CENP-T histone fold | 35 | 77 | 6.8E-8 |
8 | g2440.t1 | ProSitePatterns | PS00047 | Histone H4 signature. | 15 | 19 | - |
7 | g2440.t1 | SMART | SM00417 | h44 | 17 | 71 | 4.8E-24 |
6 | g2440.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 4 | 83 | 1.86E-21 |
IUPRED3 score over 0.5 is predictive of a disordered region.
GOID | TERM | ONTOLOGY |
---|---|---|
GO:0003677 | DNA binding | MF |
GO:0046982 | protein heterodimerization activity | MF |
GO:0000786 | nucleosome | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed