General information for g2855.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Somatostatin receptor type 2.
Parent gene
- The parent gene g2855 is located on chr_3: 20671896..20673439 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2855 | g2855.t1 | isoform | g2855.t1 | 20671896 | 20673439 |
| chr_3 | g2855 | g2855.t1 | exon | g2855.t1.exon1 | 20671896 | 20672617 |
| chr_3 | g2855 | g2855.t1 | cds | g2855.t1.CDS1 | 20671896 | 20672617 |
| chr_3 | g2855 | g2855.t1 | exon | g2855.t1.exon2 | 20672691 | 20672804 |
| chr_3 | g2855 | g2855.t1 | cds | g2855.t1.CDS2 | 20672691 | 20672804 |
| chr_3 | g2855 | g2855.t1 | exon | g2855.t1.exon3 | 20672873 | 20672986 |
| chr_3 | g2855 | g2855.t1 | cds | g2855.t1.CDS3 | 20672873 | 20672986 |
| chr_3 | g2855 | g2855.t1 | exon | g2855.t1.exon4 | 20673043 | 20673143 |
| chr_3 | g2855 | g2855.t1 | cds | g2855.t1.CDS4 | 20673043 | 20673143 |
| chr_3 | g2855 | g2855.t1 | exon | g2855.t1.exon5 | 20673216 | 20673439 |
| chr_3 | g2855 | g2855.t1 | cds | g2855.t1.CDS5 | 20673216 | 20673439 |
| chr_3 | g2855 | g2855.t1 | TSS | g2855.t1 | 20673682 | 20673682 |
| chr_3 | g2855 | g2855.t1 | TTS | g2855.t1 | NA | NA |
Sequences
>g2855.t1 Gene=g2855 Length=1275
ATGGAGGAATTTTTAATGTTTGACAATGTCACAAATTTTGATGAAATTTTCACTCGAAAT
CAGAGTGTAATCAATAATGATGAGGATTTTGATACCACAAATTATTGTCCGTATATCGAT
GCGAGTCCTATTTCCCACGTTCTATTAGCCATATTGTACGCAATCATTTGCTTTATTGGC
GTTTTCGGTAATTCGTTAGTCATTTTTGTTATTATCAAATTTAGCAAGATGCAAACAATT
ACGAACTTCTATATCTTAAATCTCGCTATTGCTGATCAATTTTTCCTCATTGGAATTCCA
TTTTTAATTTTCACAATGTTCTATGGTCAATGGATTTTTGGTGATTGGTTTTGCAAACTC
TACATGATAAGTCAATCGATAACTCAATTGTCAACATCGTACTTTCTTCTTATTATGAGT
GCCGATCGCTACATTGCTGTTTGTCATCCAATAGAATTATCACCACGCTATCGAAATCCA
ACAGTGTCAAAAATCATATCGATTCTGCTATGGGTATTTTCATTTCTCCTGATGTCGCCA
GTTATTTTGTATTCAAATACAATTGAAAAGAGCGAAAATGGAACAGCAAGATCGTGTATT
ATCAAATGGAATTTAGATGATAACAACAATGTTGATGAGCCTTATGCATTCATTCTTTAC
TCATTTATTGTTGGCTTTGCTGTGCCTTTAGTTTTAATAATGACATTTTATTTTCTTGTC
ATAAAAAAACTTCGATCACTACGTTCACGTTCAAAGTCAAAAGAGAGAAAACGGTCACAT
CGTAAAGTAACGAAATTAGTACTTATAATTATTGCAATGTATGTTTGTTTTTGGTCTCCA
TACTGGATGCTTCAAATTTATACAATTACACTCCCACCTGATCATTGTAAGACTAAACTT
GAAGTCATCATTTATTTACTATGCGGTTGCCTCGTGTACCTTAACAGCTCTCTTAATCCA
TTATTGTACGCATTTCTCAGTGATTCATTTAAGAAAAGCTTCCTTAAGGCATGCTCGTGT
GCAAATAAAAATGATTTCTTCATTTATCAGACCGACAGTCCTGCACATAGTCGCATTAGC
AAGAACCGTAGTTCAGAAAAGCATCGTTATTATACATCAGTATCGACGAGAATCAGTCGC
ATTGAAAGTAAATGTCGAAGGAAGAAAAGCAAGGAAAATGCTTCCGTGGTATTAACGGAT
GATTCAAAGGAAATTATTTTGATCTCGTCAAACAACGTCACTCGAAAAGGGGAAATTTTG
CAGACTGATTTATGA
>g2855.t1 Gene=g2855 Length=424
MEEFLMFDNVTNFDEIFTRNQSVINNDEDFDTTNYCPYIDASPISHVLLAILYAIICFIG
VFGNSLVIFVIIKFSKMQTITNFYILNLAIADQFFLIGIPFLIFTMFYGQWIFGDWFCKL
YMISQSITQLSTSYFLLIMSADRYIAVCHPIELSPRYRNPTVSKIISILLWVFSFLLMSP
VILYSNTIEKSENGTARSCIIKWNLDDNNNVDEPYAFILYSFIVGFAVPLVLIMTFYFLV
IKKLRSLRSRSKSKERKRSHRKVTKLVLIIIAMYVCFWSPYWMLQIYTITLPPDHCKTKL
EVIIYLLCGCLVYLNSSLNPLLYAFLSDSFKKSFLKACSCANKNDFFIYQTDSPAHSRIS
KNRSSEKHRYYTSVSTRISRIESKCRRKKSKENASVVLTDDSKEIILISSNNVTRKGEIL
QTDL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 15 | g2855.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 11 | 365 | 5.0E-81 |
| 2 | g2855.t1 | PANTHER | PTHR24229:SF51 | ALLATOSTATIN C RECEPTOR 1-RELATED | 34 | 346 | 1.0E-109 |
| 3 | g2855.t1 | PANTHER | PTHR24229 | NEUROPEPTIDES RECEPTOR | 34 | 346 | 1.0E-109 |
| 13 | g2855.t1 | PRINTS | PR00246 | Somatostatin receptor signature | 45 | 57 | 5.3E-9 |
| 8 | g2855.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 48 | 72 | 1.7E-46 |
| 9 | g2855.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 81 | 102 | 1.7E-46 |
| 6 | g2855.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 125 | 147 | 1.7E-46 |
| 5 | g2855.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 162 | 183 | 1.7E-46 |
| 10 | g2855.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 218 | 241 | 1.7E-46 |
| 11 | g2855.t1 | PRINTS | PR00246 | Somatostatin receptor signature | 252 | 265 | 5.3E-9 |
| 7 | g2855.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 263 | 287 | 1.7E-46 |
| 4 | g2855.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 305 | 331 | 1.7E-46 |
| 12 | g2855.t1 | PRINTS | PR00246 | Somatostatin receptor signature | 325 | 337 | 5.3E-9 |
| 1 | g2855.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 63 | 323 | 3.9E-51 |
| 20 | g2855.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 46 | - |
| 25 | g2855.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 47 | 72 | - |
| 17 | g2855.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 73 | 83 | - |
| 26 | g2855.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 108 | - |
| 22 | g2855.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 109 | 119 | - |
| 24 | g2855.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 120 | 141 | - |
| 19 | g2855.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 142 | 161 | - |
| 30 | g2855.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 162 | 184 | - |
| 21 | g2855.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 185 | 216 | - |
| 29 | g2855.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 217 | 241 | - |
| 16 | g2855.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 242 | 261 | - |
| 28 | g2855.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 262 | 282 | - |
| 23 | g2855.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 283 | 301 | - |
| 27 | g2855.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 302 | 326 | - |
| 18 | g2855.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 327 | 424 | - |
| 38 | g2855.t1 | ProSitePatterns | PS00237 | G-protein coupled receptors family 1 signature. | 131 | 147 | - |
| 40 | g2855.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 63 | 323 | 47.554 |
| 39 | g2855.t1 | SMART | SM01381 | 7TM_GPCR_Srsx_2 | 57 | 338 | 1.4E-4 |
| 14 | g2855.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 8 | 346 | 1.74E-73 |
| 33 | g2855.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 72 | - |
| 35 | g2855.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 106 | - |
| 32 | g2855.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 121 | 138 | - |
| 37 | g2855.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 166 | 188 | - |
| 34 | g2855.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 218 | 240 | - |
| 36 | g2855.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 266 | 288 | - |
| 31 | g2855.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 303 | 325 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004994 | somatostatin receptor activity | MF |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K04221 (somatostatin receptor 5)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed