General information for g2925.t23
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Hexokinase type 2.
Parent gene
- The parent gene g2925 is located on chr_3: 21273540..21284647 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2925 | g2925.t23 | TSS | g2925.t23 | 21267310 | 21267310 |
| chr_3 | g2925 | g2925.t23 | isoform | g2925.t23 | 21267719 | 21271507 |
| chr_3 | g2925 | g2925.t23 | exon | g2925.t23.exon1 | 21267719 | 21267778 |
| chr_3 | g2925 | g2925.t23 | cds | g2925.t23.CDS1 | 21267719 | 21267778 |
| chr_3 | g2925 | g2925.t23 | exon | g2925.t23.exon2 | 21271023 | 21271185 |
| chr_3 | g2925 | g2925.t23 | cds | g2925.t23.CDS2 | 21271023 | 21271185 |
| chr_3 | g2925 | g2925.t23 | exon | g2925.t23.exon3 | 21271251 | 21271435 |
| chr_3 | g2925 | g2925.t23 | cds | g2925.t23.CDS3 | 21271251 | 21271435 |
| chr_3 | g2925 | g2925.t23 | exon | g2925.t23.exon4 | 21271497 | 21271507 |
| chr_3 | g2925 | g2925.t23 | cds | g2925.t23.CDS4 | 21271497 | 21271505 |
| chr_3 | g2925 | g2925.t23 | TTS | g2925.t23 | NA | NA |
Sequences
>g2925.t23 Gene=g2925 Length=419
ATGGATTTGATAAAAAATATAAAGGACATAATTATTGGAGAACGAAGTAATTCGGATCTC
ATCAAGGAAGCCTGTCAGGAGTTGATATTGGATGACAAAACAATGAGAGAAATCATGAAG
AGATTTCTTCATGAAATTCAACTTGGGTTAAAGAAAGAGACACATCCAGCAGCTGACATT
AAGTGCTTCATAACTTACGTTCAAGATTTGCCAAATGGAAAAGAAAAAGGCAGATTCCTT
GCATTGGATTTAGGTGGTACGAATTTCCGTGTCCTTCTTATTCATCTCAAAGGTGACAGT
GAGTTCGAAATGCAATCAAAGATTTACGCCATCCCACAAAGTATTATGATTGGTTCGGGA
ACACAATTGTTTGACCATATTGCTGAATGTCTTGCAAATTTCATCAAGGAACATAAACT
>g2925.t23 Gene=g2925 Length=139
MDLIKNIKDIIIGERSNSDLIKEACQELILDDKTMREIMKRFLHEIQLGLKKETHPAADI
KCFITYVQDLPNGKEKGRFLALDLGGTNFRVLLIHLKGDSEFEMQSKIYAIPQSIMIGSG
TQLFDHIAECLANFIKEHK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g2925.t23 | Gene3D | G3DSA:3.40.367.20 | - | 26 | 64 | 0.000 |
| 5 | g2925.t23 | Gene3D | G3DSA:3.30.420.40 | - | 65 | 139 | 0.000 |
| 2 | g2925.t23 | PANTHER | PTHR19443:SF4 | HEXOKINASE-2 | 21 | 138 | 0.000 |
| 3 | g2925.t23 | PANTHER | PTHR19443 | HEXOKINASE | 21 | 138 | 0.000 |
| 1 | g2925.t23 | Pfam | PF00349 | Hexokinase | 21 | 138 | 0.000 |
| 7 | g2925.t23 | ProSiteProfiles | PS51748 | Hexokinase domain profile. | 15 | 139 | 13.584 |
| 4 | g2925.t23 | SUPERFAMILY | SSF53067 | Actin-like ATPase domain | 18 | 138 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0001678 | cellular glucose homeostasis | BP |
| GO:0005524 | ATP binding | MF |
| GO:0016773 | phosphotransferase activity, alcohol group as acceptor | MF |
| GO:0005975 | carbohydrate metabolic process | BP |
| GO:0005536 | glucose binding | MF |
| GO:0004396 | hexokinase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed