General information for g3322.t8
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g3322 is located on chr_3: 24645415..24645845 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3322 | g3322.t8 | TTS | g3322.t8 | 24645006 | 24645006 |
| chr_3 | g3322 | g3322.t8 | isoform | g3322.t8 | 24645075 | 24645621 |
| chr_3 | g3322 | g3322.t8 | exon | g3322.t8.exon1 | 24645075 | 24645151 |
| chr_3 | g3322 | g3322.t8 | cds | g3322.t8.CDS1 | 24645075 | 24645151 |
| chr_3 | g3322 | g3322.t8 | exon | g3322.t8.exon2 | 24645213 | 24645380 |
| chr_3 | g3322 | g3322.t8 | cds | g3322.t8.CDS2 | 24645213 | 24645380 |
| chr_3 | g3322 | g3322.t8 | exon | g3322.t8.exon3 | 24645430 | 24645481 |
| chr_3 | g3322 | g3322.t8 | cds | g3322.t8.CDS3 | 24645430 | 24645436 |
| chr_3 | g3322 | g3322.t8 | exon | g3322.t8.exon4 | 24645585 | 24645621 |
| chr_3 | g3322 | g3322.t8 | TSS | g3322.t8 | 24645701 | 24645701 |
Sequences
>g3322.t8 Gene=g3322 Length=334
ATGTCTTACGTTATTCGTCGTGGACCTAGAAAAATTACTGCTATCGGTCGCTGGGCATAT
AATTTGTCAGGATTCAATCAATATGGTAAGTCTCCATCATGATGATGTTTTGTACGAAAC
TGAGGATGTAAAGGAAGCTCTTCGACGTCTGCCACAACAATACGTTGATGAAAGAAATTT
TAGAATTACTCGCGCATTGCATCTTTCAATGACTAAGACTATTTTGCCTAAAGATCAGTG
GACAAAATACGAAGAAGATTTCAGATATTTAGAGCCATACTTGGAAGAAGTTCAAAGAGA
ACGTGAAGAAAAGGAAGAATGGAATAAGCAGTAA
>g3322.t8 Gene=g3322 Length=83
MVSLHHDDVLYETEDVKEALRRLPQQYVDERNFRITRALHLSMTKTILPKDQWTKYEEDF
RYLEPYLEEVQREREEKEEWNKQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g3322.t8 | Coils | Coil | Coil | 63 | 83 | - |
| 5 | g3322.t8 | Gene3D | G3DSA:1.10.1090.10 | Cytochrome Bc1 Complex; Chain F | 1 | 83 | 8.0E-36 |
| 2 | g3322.t8 | PANTHER | PTHR12022 | UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KD PROTEIN | 4 | 82 | 2.3E-28 |
| 3 | g3322.t8 | PANTHER | PTHR12022:SF0 | CYTOCHROME B-C1 COMPLEX SUBUNIT 7 | 4 | 82 | 2.3E-28 |
| 7 | g3322.t8 | PIRSF | PIRSF000022 | Bc1_14K | 1 | 83 | 5.4E-38 |
| 1 | g3322.t8 | Pfam | PF02271 | Ubiquinol-cytochrome C reductase complex 14kD subunit | 2 | 78 | 6.9E-29 |
| 4 | g3322.t8 | SUPERFAMILY | SSF81524 | 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) | 4 | 82 | 5.49E-33 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005750 | mitochondrial respiratory chain complex III | CC |
| GO:0006122 | mitochondrial electron transport, ubiquinol to cytochrome c | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
