General information for g4076.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Proteasome subunit alpha type-4.
Parent gene
- The parent gene g4076 is located on chr_3: 30465729..30470147 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4076 | g4076.t3 | TSS | g4076.t3 | 30464628 | 30464628 |
| chr_3 | g4076 | g4076.t3 | isoform | g4076.t3 | 30464746 | 30465349 |
| chr_3 | g4076 | g4076.t3 | exon | g4076.t3.exon1 | 30464746 | 30464748 |
| chr_3 | g4076 | g4076.t3 | cds | g4076.t3.CDS1 | 30464746 | 30464748 |
| chr_3 | g4076 | g4076.t3 | exon | g4076.t3.exon2 | 30464874 | 30465349 |
| chr_3 | g4076 | g4076.t3 | cds | g4076.t3.CDS2 | 30464874 | 30465347 |
| chr_3 | g4076 | g4076.t3 | TTS | g4076.t3 | 30465804 | 30465804 |
Sequences
>g4076.t3 Gene=g4076 Length=479
ATGGCACGCAGATATGATTCAAGAACCACTATCTTTTCACCAGAAGGTCGTTTGTATCAA
GTAGAATATGCTATGGAGGCAATTTCGCATGCTGGTACTTGCTTAGGAATTTTAGCAAAA
GACGGAATTCTGTTGGCAGCTGAACGCCGAAATATTAATAAACTTCTCGATAATAGCATC
TTTGCTGAAAAGATTTACAGATTAAATGAAGATATGGTCTGCAGCGTTGCTGGAATTACA
TCTGATGCAAACGTTCTCACAAATGAGTTACGTTTAATTGCACAACGATATCAATTACAG
TATGATGAGCCAATTCCAGTTGAACAATTGGTTTCAAGCTTATGTGATCTAAAGCAAGCA
TACACACAATATGGTGGTAAACGTCCGTTTGGAGTATCGATTCTTTACATGGGTTGGGAT
AAGCACTATGGATATCAATTGTATCAATCAGATCCAAGTGGAAATTATAGTGGATGGAA
>g4076.t3 Gene=g4076 Length=159
MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAKDGILLAAERRNINKLLDNSI
FAEKIYRLNEDMVCSVAGITSDANVLTNELRLIAQRYQLQYDEPIPVEQLVSSLCDLKQA
YTQYGGKRPFGVSILYMGWDKHYGYQLYQSDPSGNYSGW
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g4076.t3 | Gene3D | G3DSA:3.60.20.10 | Glutamine Phosphoribosylpyrophosphate | 1 | 159 | 6.2E-70 |
| 3 | g4076.t3 | PANTHER | PTHR11599:SF13 | PROTEASOME SUBUNIT ALPHA TYPE-4 | 1 | 159 | 1.0E-79 |
| 4 | g4076.t3 | PANTHER | PTHR11599 | PROTEASOME SUBUNIT ALPHA/BETA | 1 | 159 | 1.0E-79 |
| 2 | g4076.t3 | Pfam | PF10584 | Proteasome subunit A N-terminal signature | 5 | 27 | 9.1E-14 |
| 1 | g4076.t3 | Pfam | PF00227 | Proteasome subunit | 29 | 159 | 1.4E-43 |
| 7 | g4076.t3 | ProSitePatterns | PS00388 | Proteasome alpha-type subunits signature. | 5 | 27 | - |
| 8 | g4076.t3 | ProSitePatterns | PS00854 | Proteasome beta-type subunits signature. | 35 | 82 | - |
| 10 | g4076.t3 | ProSiteProfiles | PS51475 | Proteasome alpha-type subunit profile. | 20 | 159 | 62.133 |
| 6 | g4076.t3 | SMART | SM00948 | Proteasome_A_N_2 | 5 | 27 | 3.4E-11 |
| 5 | g4076.t3 | SUPERFAMILY | SSF56235 | N-terminal nucleophile aminohydrolases (Ntn hydrolases) | 4 | 159 | 1.32E-60 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0019773 | proteasome core complex, alpha-subunit complex | CC |
| GO:0051603 | proteolysis involved in cellular protein catabolic process | BP |
| GO:0006511 | ubiquitin-dependent protein catabolic process | BP |
| GO:0004298 | threonine-type endopeptidase activity | MF |
| GO:0005839 | proteasome core complex | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
