General information for g4158.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation of very long chain fatty acids protein AAEL008004.
Parent gene
- The parent gene g4158 is located on chr_3: 31052855..31054075 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4158 | g4158.t1 | TSS | g4158.t1 | 31052792 | 31052792 |
| chr_3 | g4158 | g4158.t1 | isoform | g4158.t1 | 31052855 | 31054075 |
| chr_3 | g4158 | g4158.t1 | exon | g4158.t1.exon1 | 31052855 | 31052915 |
| chr_3 | g4158 | g4158.t1 | cds | g4158.t1.CDS1 | 31052855 | 31052915 |
| chr_3 | g4158 | g4158.t1 | exon | g4158.t1.exon2 | 31052983 | 31053173 |
| chr_3 | g4158 | g4158.t1 | cds | g4158.t1.CDS2 | 31052983 | 31053173 |
| chr_3 | g4158 | g4158.t1 | exon | g4158.t1.exon3 | 31053336 | 31053564 |
| chr_3 | g4158 | g4158.t1 | cds | g4158.t1.CDS3 | 31053336 | 31053564 |
| chr_3 | g4158 | g4158.t1 | exon | g4158.t1.exon4 | 31053616 | 31053770 |
| chr_3 | g4158 | g4158.t1 | cds | g4158.t1.CDS4 | 31053616 | 31053770 |
| chr_3 | g4158 | g4158.t1 | exon | g4158.t1.exon5 | 31053836 | 31053922 |
| chr_3 | g4158 | g4158.t1 | cds | g4158.t1.CDS5 | 31053836 | 31053922 |
| chr_3 | g4158 | g4158.t1 | exon | g4158.t1.exon6 | 31053989 | 31054075 |
| chr_3 | g4158 | g4158.t1 | cds | g4158.t1.CDS6 | 31053989 | 31054075 |
| chr_3 | g4158 | g4158.t1 | TTS | g4158.t1 | NA | NA |
Sequences
>g4158.t1 Gene=g4158 Length=810
ATGGCCTTAGTTATACAGAAAATTTATGATGGGTATAAATATTTCTTCTATGAAATTAAG
GATGAACGTTCGCAAGATTTTTTCCTAATTTCTAATCCACCTATACCATTTGCAATGATT
CTTATTGGATATATTTTAATGGTAAAATATGGACCTATATACATGAAAATGAGAAAACCA
TATGACCTAAAATATGTCATGATGGTTTACAATTTCTTTCAAGTCTATTTCAACGTTACA
ATAGGGATTGAGGCTGTCTACAAAATTTTAATAAAAGGCTCTTTTAATTATCAATGTGAA
AATTCAGACTATAGTAACACACCAAGGGGATTATTATTTGTACGAATGAGTTATTACTAC
TTTCTGCTTAAAGTTCTTGATTTAATGGATACTTTATTTATCATACTGAAGAAAAAAGAT
TCACATCTTTCTTTCTTACATTGTTATCACCACTTCTTCATGGCATTAGGCACATATATT
GCTGTTCGATGGGTGCCTGGTGGTCATTCAACTATGCTTGGAATAATAAATTCATTCGTT
CACGGTTTTATGTACTCTTATTATTTTTTGACTGCTTTTAAACCTGAACTAAAACAATCA
ATATGGTGGAAAAAGCATATAACTCAAATTCAATTGATTCAATTCGCTTTCCTCTTAGTT
CATTATTTACGTGGAGCTTTAGCAGTTAATTGCACTTATCCGAAATTTTGGTTATGGGTT
ATGGTTATACAAAATATATTTATGCTATCGTTGTTCGGTGATTTCTACTATAAGGCATAC
ATTAAAAAAAGAGAAAAAAAGTCACAATGA
>g4158.t1 Gene=g4158 Length=269
MALVIQKIYDGYKYFFYEIKDERSQDFFLISNPPIPFAMILIGYILMVKYGPIYMKMRKP
YDLKYVMMVYNFFQVYFNVTIGIEAVYKILIKGSFNYQCENSDYSNTPRGLLFVRMSYYY
FLLKVLDLMDTLFIILKKKDSHLSFLHCYHHFFMALGTYIAVRWVPGGHSTMLGIINSFV
HGFMYSYYFLTAFKPELKQSIWWKKHITQIQLIQFAFLLVHYLRGALAVNCTYPKFWLWV
MVIQNIFMLSLFGDFYYKAYIKKREKKSQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g4158.t1 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 3 | 264 | 6.3E-84 |
| 3 | g4158.t1 | PANTHER | PTHR11157:SF21 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN | 3 | 264 | 6.3E-84 |
| 1 | g4158.t1 | Pfam | PF01151 | GNS1/SUR4 family | 34 | 267 | 6.9E-57 |
| 16 | g4158.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 26 | - |
| 20 | g4158.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 47 | - |
| 12 | g4158.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 48 | 67 | - |
| 23 | g4158.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 87 | - |
| 15 | g4158.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 88 | 117 | - |
| 25 | g4158.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 118 | 136 | - |
| 13 | g4158.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 137 | 147 | - |
| 22 | g4158.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 148 | 165 | - |
| 18 | g4158.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 166 | 170 | - |
| 19 | g4158.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 171 | 190 | - |
| 11 | g4158.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 191 | 209 | - |
| 21 | g4158.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 210 | 230 | - |
| 17 | g4158.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 231 | 235 | - |
| 24 | g4158.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 236 | 257 | - |
| 14 | g4158.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 258 | 269 | - |
| 9 | g4158.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 26 | 48 | - |
| 7 | g4158.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 69 | 91 | - |
| 4 | g4158.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 114 | 136 | - |
| 8 | g4158.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 165 | - |
| 6 | g4158.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 171 | 193 | - |
| 5 | g4158.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 206 | 228 | - |
| 10 | g4158.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 238 | 260 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed