General information for g4159.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation of very long chain fatty acids protein 4.
Parent gene
- The parent gene g4159 is located on chr_3: 31054430..31055828 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4159 | g4159.t1 | isoform | g4159.t1 | 31054430 | 31055828 |
| chr_3 | g4159 | g4159.t1 | exon | g4159.t1.exon1 | 31054430 | 31054478 |
| chr_3 | g4159 | g4159.t1 | cds | g4159.t1.CDS1 | 31054430 | 31054478 |
| chr_3 | g4159 | g4159.t1 | exon | g4159.t1.exon2 | 31054543 | 31054739 |
| chr_3 | g4159 | g4159.t1 | cds | g4159.t1.CDS2 | 31054543 | 31054739 |
| chr_3 | g4159 | g4159.t1 | exon | g4159.t1.exon3 | 31055119 | 31055247 |
| chr_3 | g4159 | g4159.t1 | cds | g4159.t1.CDS3 | 31055119 | 31055247 |
| chr_3 | g4159 | g4159.t1 | exon | g4159.t1.exon4 | 31055304 | 31055401 |
| chr_3 | g4159 | g4159.t1 | cds | g4159.t1.CDS4 | 31055304 | 31055401 |
| chr_3 | g4159 | g4159.t1 | exon | g4159.t1.exon5 | 31055462 | 31055609 |
| chr_3 | g4159 | g4159.t1 | cds | g4159.t1.CDS5 | 31055462 | 31055609 |
| chr_3 | g4159 | g4159.t1 | exon | g4159.t1.exon6 | 31055667 | 31055828 |
| chr_3 | g4159 | g4159.t1 | cds | g4159.t1.CDS6 | 31055667 | 31055828 |
| chr_3 | g4159 | g4159.t1 | TSS | g4159.t1 | NA | NA |
| chr_3 | g4159 | g4159.t1 | TTS | g4159.t1 | NA | NA |
Sequences
>g4159.t1 Gene=g4159 Length=783
ATGGGTTCACTTATTGATAAATATATTTTTTCCTTCTATACTGTAAAAGATCAACGAGCA
AAAGAACTAGCTTTGCCTTTCACGGAGAGTCCTCCTATACCAATGTTAATACTTGTATTT
TCGTATATTACATTATTTAATTATGGTCCAAAATTAATGGCAAAAAGAAAAGCATTTGTT
TTAAAAAATTTTATGATTTTTTACAATTTACTTCAAGTTTTGATGAACACATTAGCAGCA
ATTGCGGCTTTATATTTTTTATTTTGGAAAAATGGTTTCAACTTTAAATGTCATCCAATT
GACACTTCTAATGATGTAGAATATATTTTTACATACATATATTTTGCATTCAAAGTAATT
GATTTATTTGATACAGTGTTCATTGTTTTGAGAAAAAATAATAAACAACTTAGTTTCCTA
CATTGTTATCATCATCTTATGATGTGTTGCGCAACCTATACAGGAATTATGTGGTTTCCT
GGAGGAAGCGCAATACTTTTAGGCGTTCTCAATTCATTTGTGCATTCGATTATGTACAGT
TATTTTTTAATGACATCACTTAATAATGGAAAAATAAAAAATTCTCTATGGTGGAAGAAA
CATATCACTCATATTCAATTGATACAATTTATAATTCTGACAGTAGTATATACTCAAACA
TTTTTTGCTCCCAATTGCAGCTATCCAATATATTTAAGAGTGGTACTACTTTCTCAGAGT
GTCTTTATGCTTTATCTTTTTTCAAATTTTTATATCACAGCTTATGTCAAGAAAAATAAA
TAA
>g4159.t1 Gene=g4159 Length=260
MGSLIDKYIFSFYTVKDQRAKELALPFTESPPIPMLILVFSYITLFNYGPKLMAKRKAFV
LKNFMIFYNLLQVLMNTLAAIAALYFLFWKNGFNFKCHPIDTSNDVEYIFTYIYFAFKVI
DLFDTVFIVLRKNNKQLSFLHCYHHLMMCCATYTGIMWFPGGSAILLGVLNSFVHSIMYS
YFLMTSLNNGKIKNSLWWKKHITHIQLIQFIILTVVYTQTFFAPNCSYPIYLRVVLLSQS
VFMLYLFSNFYITAYVKKNK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g4159.t1 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 4 | 257 | 8.0E-70 |
| 3 | g4159.t1 | PANTHER | PTHR11157:SF21 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN | 4 | 257 | 8.0E-70 |
| 1 | g4159.t1 | Pfam | PF01151 | GNS1/SUR4 family | 32 | 260 | 8.2E-50 |
| 17 | g4159.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 32 | - |
| 22 | g4159.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 33 | 54 | - |
| 11 | g4159.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 55 | 65 | - |
| 25 | g4159.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 66 | 89 | - |
| 18 | g4159.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 90 | 108 | - |
| 21 | g4159.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 109 | 130 | - |
| 14 | g4159.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 131 | 141 | - |
| 20 | g4159.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 142 | 159 | - |
| 16 | g4159.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 160 | 164 | - |
| 19 | g4159.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 165 | 184 | - |
| 13 | g4159.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 185 | 204 | - |
| 23 | g4159.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 205 | 224 | - |
| 15 | g4159.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 225 | 229 | - |
| 24 | g4159.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 230 | 252 | - |
| 12 | g4159.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 253 | 260 | - |
| 5 | g4159.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 23 | 45 | - |
| 4 | g4159.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 66 | 88 | - |
| 10 | g4159.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 108 | 130 | - |
| 6 | g4159.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 137 | 159 | - |
| 7 | g4159.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 164 | 183 | - |
| 9 | g4159.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 204 | 223 | - |
| 8 | g4159.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 230 | 252 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K10245 (fatty acid elongase 2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed