Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g4173 g4173.t1 isoform g4173.t1 31219684 31219968
chr_3 g4173 g4173.t1 exon g4173.t1.exon1 31219684 31219968
chr_3 g4173 g4173.t1 cds g4173.t1.CDS1 31219684 31219968
chr_3 g4173 g4173.t1 TSS g4173.t1 NA NA
chr_3 g4173 g4173.t1 TTS g4173.t1 NA NA

Sequences

>g4173.t1 Gene=g4173 Length=285
ATGAATAATAGATCGAAGAATTCAGACCGTCGCAATAATTCAACAATTGCAGTTAAGAAT
CAACAAGTTGATTCTAACCTCAAATATGCGTCAAATGTTTCGATGGATTTTGGAAATGAT
TCAGTCAAAGAAGATGATAAGTCATCAAAAATTAAACCGATCATTGTGGATAGTGGAATA
GCCCCGAGTTATACCCAAAAAACCGCGGTGAAATGTTCGTTCGTCTGTGAACACGTTACA
GCTCACAGATTTCACTTTTTCGTCAAAATTCTTGAATATTCATAA

>g4173.t1 Gene=g4173 Length=94
MNNRSKNSDRRNNSTIAVKNQQVDSNLKYASNVSMDFGNDSVKEDDKSSKIKPIIVDSGI
APSYTQKTAVKCSFVCEHVTAHRFHFFVKILEYS

Protein features from InterProScan

No InterPro annotations for this transcript.

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed