General information for g44.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Probable cytochrome P450 6a20.
Parent gene
- The parent gene g44 is located on chr_3: 406315..406626 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g44 | g44.t1 | TSS | g44.t1 | 405320 | 405320 |
| chr_3 | g44 | g44.t1 | isoform | g44.t1 | 406315 | 406626 |
| chr_3 | g44 | g44.t1 | exon | g44.t1.exon1 | 406315 | 406626 |
| chr_3 | g44 | g44.t1 | cds | g44.t1.CDS1 | 406315 | 406626 |
| chr_3 | g44 | g44.t1 | TTS | g44.t1 | 406684 | 406684 |
Sequences
>g44.t1 Gene=g44 Length=312
ATGGTTCCGATTTTGGCAATTCATCACGATCCACTTTATTATCCAGAACCAAATAATTTT
GATCCCGAGAGATTTGATGAGGAAAAAATTCGACAAAGACCAGCTTTTACATTTTTACCA
TTTGGTGATGGAATGAGAAATTGTATTGGAATGCGATTTGCACTTCTTCAAGCTAAAATT
GCAATAGCAAAACTCATTCTTAATTTTGAGTTTTCAGTTTGTGATAAGACAACAATTCCA
ATAGAATTTAATGCATCAACACCATTTTTAACACCAAAATCTGAAATTTATTTGTCAGTG
AAAAAATTATAA
>g44.t1 Gene=g44 Length=103
MVPILAIHHDPLYYPEPNNFDPERFDEEKIRQRPAFTFLPFGDGMRNCIGMRFALLQAKI
AIAKLILNFEFSVCDKTTIPIEFNASTPFLTPKSEIYLSVKKL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g44.t1 | Gene3D | G3DSA:1.10.630.10 | Cytochrome p450 | 1 | 103 | 1.4E-35 |
| 2 | g44.t1 | PANTHER | PTHR24292 | CYTOCHROME P450 | 1 | 100 | 4.0E-35 |
| 3 | g44.t1 | PRINTS | PR00463 | E-class P450 group I signature | 3 | 27 | 7.5E-12 |
| 5 | g44.t1 | PRINTS | PR00463 | E-class P450 group I signature | 38 | 48 | 7.5E-12 |
| 4 | g44.t1 | PRINTS | PR00463 | E-class P450 group I signature | 48 | 71 | 7.5E-12 |
| 1 | g44.t1 | Pfam | PF00067 | Cytochrome P450 | 1 | 99 | 6.7E-31 |
| 7 | g44.t1 | ProSitePatterns | PS00086 | Cytochrome P450 cysteine heme-iron ligand signature. | 41 | 50 | - |
| 6 | g44.t1 | SUPERFAMILY | SSF48264 | Cytochrome P450 | 1 | 101 | 8.25E-33 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0020037 | heme binding | MF |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | MF |
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
