General information for g4784.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Elongation of very long chain fatty acids protein.
Parent gene
- The parent gene g4784 is located on chr_2: 4953170..4959330 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g4784 | g4784.t1 | TTS | g4784.t1 | 4952994 | 4952994 |
| chr_2 | g4784 | g4784.t1 | isoform | g4784.t1 | 4953170 | 4954584 |
| chr_2 | g4784 | g4784.t1 | exon | g4784.t1.exon1 | 4953170 | 4953630 |
| chr_2 | g4784 | g4784.t1 | cds | g4784.t1.CDS1 | 4953170 | 4953630 |
| chr_2 | g4784 | g4784.t1 | exon | g4784.t1.exon2 | 4953695 | 4953830 |
| chr_2 | g4784 | g4784.t1 | cds | g4784.t1.CDS2 | 4953695 | 4953830 |
| chr_2 | g4784 | g4784.t1 | exon | g4784.t1.exon3 | 4953889 | 4954077 |
| chr_2 | g4784 | g4784.t1 | cds | g4784.t1.CDS3 | 4953889 | 4954077 |
| chr_2 | g4784 | g4784.t1 | exon | g4784.t1.exon4 | 4954444 | 4954584 |
| chr_2 | g4784 | g4784.t1 | cds | g4784.t1.CDS4 | 4954444 | 4954584 |
| chr_2 | g4784 | g4784.t1 | TSS | g4784.t1 | NA | NA |
Sequences
>g4784.t1 Gene=g4784 Length=927
ATGGAGATTTTTAACAAAATCAATGCAGGATGGCGTGATTTGATGGATAATAAATCAGAT
CCTAGAGTAGCTAATTGGCCTCTAATGTCATCACCACTGCCAACAATAATTATTTGCTTG
TCATATGTCTATATCGTTAAGGTTTTGGGTCCGAAAATGATGGAAAACAGAAAACCTTTT
AAATTAAGAGGAATAATCATTGCATACAACTTTTTCCAAGTGCTATTCTCCTTTTACTTA
TTCTGGGAAGCTGGAGTAACTGGCTGGTTTGGAAATTACAATTTCAGATGCCAAACAGTT
GATTTCTCATTAGAAGGAATGGCATTGAGGACTGCTCAAGGATGTTGGTGGTATTATTTC
AGTAAATTCACAGAATTTTTCGATACATTCTTCTTCGTTTTGAGAAAAAGATATGATCAA
GTTTCTACATTGCACGTCATTCATCATGGTCTCATGCCATTCAGTGTTTGGTGGGGAGTG
AAGTTTATGGCTGGTGGTCATAGCACATTTTTCGGTTTCCTTAATACATTTGTTCATATT
GTGATGTATACTTATTACATGTTGGCTGCAATTGGACCAGAAATGCAGAAATATCTCTGG
TGGAAAAAATATTTAACAATTTTGCAAATGATTCAATTTATTGCAATTTTTGTTCACGCT
CTTCAACTTTTCTTTCATAATCCATGCAATTATCCAATTGTTTTTGCCTATTGGATTGCA
GCTCATGGTGTTTTGTTCTTATTCCTCTTTTCAAATTTTTACAAAAAAGCTTACACAGTG
AAAACCAACAAGAAGAAAAAGATCGAAGACATTAATGGAAATATTATGACTAAAATTGGG
AATGAAATTATTACAAATAAATCAATTGAAAATGCTGAGAACTATTCAAGAACTAGAATA
GTTTCGAATGGAATTTCATCACATTAA
>g4784.t1 Gene=g4784 Length=308
MEIFNKINAGWRDLMDNKSDPRVANWPLMSSPLPTIIICLSYVYIVKVLGPKMMENRKPF
KLRGIIIAYNFFQVLFSFYLFWEAGVTGWFGNYNFRCQTVDFSLEGMALRTAQGCWWYYF
SKFTEFFDTFFFVLRKRYDQVSTLHVIHHGLMPFSVWWGVKFMAGGHSTFFGFLNTFVHI
VMYTYYMLAAIGPEMQKYLWWKKYLTILQMIQFIAIFVHALQLFFHNPCNYPIVFAYWIA
AHGVLFLFLFSNFYKKAYTVKTNKKKKIEDINGNIMTKIGNEIITNKSIENAENYSRTRI
VSNGISSH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g4784.t1 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 5 | 274 | 2.4E-149 |
| 3 | g4784.t1 | PANTHER | PTHR11157:SF151 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN | 5 | 274 | 2.4E-149 |
| 1 | g4784.t1 | Pfam | PF01151 | GNS1/SUR4 family | 28 | 266 | 1.6E-62 |
| 16 | g4784.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 30 | - |
| 24 | g4784.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 31 | 50 | - |
| 13 | g4784.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 51 | 61 | - |
| 21 | g4784.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 82 | - |
| 17 | g4784.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 83 | 115 | - |
| 23 | g4784.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 134 | - |
| 12 | g4784.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 135 | 145 | - |
| 20 | g4784.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 146 | 164 | - |
| 18 | g4784.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 165 | 169 | - |
| 25 | g4784.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 170 | 192 | - |
| 14 | g4784.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 193 | 203 | - |
| 22 | g4784.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 204 | 225 | - |
| 15 | g4784.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 226 | 230 | - |
| 19 | g4784.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 231 | 254 | - |
| 11 | g4784.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 255 | 308 | - |
| 5 | g4784.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 23 | 45 | - |
| 6 | g4784.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 65 | 87 | - |
| 9 | g4784.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 134 | - |
| 4 | g4784.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 141 | 160 | - |
| 10 | g4784.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 170 | 192 | - |
| 8 | g4784.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 204 | 226 | - |
| 7 | g4784.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 231 | 253 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K10250 (elongation of very long chain fatty acids protein 7)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed