General information for g4784.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation of very long chain fatty acids protein.
Parent gene
- The parent gene g4784 is located on chr_2: 4953170..4959330 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g4784 | g4784.t3 | TTS | g4784.t3 | 4952994 | 4952994 |
| chr_2 | g4784 | g4784.t3 | isoform | g4784.t3 | 4953170 | 4953830 |
| chr_2 | g4784 | g4784.t3 | exon | g4784.t3.exon1 | 4953170 | 4953630 |
| chr_2 | g4784 | g4784.t3 | cds | g4784.t3.CDS1 | 4953170 | 4953630 |
| chr_2 | g4784 | g4784.t3 | exon | g4784.t3.exon2 | 4953695 | 4953830 |
| chr_2 | g4784 | g4784.t3 | cds | g4784.t3.CDS2 | 4953695 | 4953707 |
| chr_2 | g4784 | g4784.t3 | TSS | g4784.t3 | NA | NA |
Sequences
>g4784.t3 Gene=g4784 Length=597
ACTGCTCAAGGATGTTGGTGGTATTATTTCAGTAAATTCACAGAATTTTTCGATACATTC
TTCTTCGTTTTGAGAAAAAGATATGATCAAGTTTCTACATTGCACGTCATTCATCATGGT
CTCATGCCATTCAGTGTTTGGTGGGGAGTGAAGTTTATGGCTGGTGGTCATAGCACATTT
TTCGGTTTCCTTAATACATTTGTTCATATTGTGATGTATACTTATTACATGTTGGCTGCA
ATTGGACCAGAAATGCAGAAATATCTCTGGTGGAAAAAATATTTAACAATTTTGCAAATG
ATTCAATTTATTGCAATTTTTGTTCACGCTCTTCAACTTTTCTTTCATAATCCATGCAAT
TATCCAATTGTTTTTGCCTATTGGATTGCAGCTCATGGTGTTTTGTTCTTATTCCTCTTT
TCAAATTTTTACAAAAAAGCTTACACAGTGAAAACCAACAAGAAGAAAAAGATCGAAGAC
ATTAATGGAAATATTATGACTAAAATTGGGAATGAAATTATTACAAATAAATCAATTGAA
AATGCTGAGAACTATTCAAGAACTAGAATAGTTTCGAATGGAATTTCATCACATTAA
>g4784.t3 Gene=g4784 Length=157
MPFSVWWGVKFMAGGHSTFFGFLNTFVHIVMYTYYMLAAIGPEMQKYLWWKKYLTILQMI
QFIAIFVHALQLFFHNPCNYPIVFAYWIAAHGVLFLFLFSNFYKKAYTVKTNKKKKIEDI
NGNIMTKIGNEIITNKSIENAENYSRTRIVSNGISSH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g4784.t3 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 1 | 125 | 1.8E-62 |
| 3 | g4784.t3 | PANTHER | PTHR11157:SF151 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN | 1 | 125 | 1.8E-62 |
| 1 | g4784.t3 | Pfam | PF01151 | GNS1/SUR4 family | 2 | 115 | 2.6E-27 |
| 10 | g4784.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 12 | g4784.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 41 | - |
| 8 | g4784.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 42 | 52 | - |
| 11 | g4784.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 74 | - |
| 9 | g4784.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 75 | 79 | - |
| 13 | g4784.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 103 | - |
| 7 | g4784.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 104 | 157 | - |
| 4 | g4784.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 18 | 40 | - |
| 6 | g4784.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 75 | - |
| 5 | g4784.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 102 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed