Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Probable cytochrome P450 6d5.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g48 g48.t2 TSS g48.t2 410853 410853
chr_3 g48 g48.t2 isoform g48.t2 410889 411525
chr_3 g48 g48.t2 exon g48.t2.exon1 410889 411235
chr_3 g48 g48.t2 cds g48.t2.CDS1 410889 411235
chr_3 g48 g48.t2 exon g48.t2.exon2 411293 411525
chr_3 g48 g48.t2 cds g48.t2.CDS2 411293 411524
chr_3 g48 g48.t2 TTS g48.t2 NA NA

Sequences

>g48.t2 Gene=g48 Length=580
ATGGGTTTTGTTTTGACATTAATAATTATTTTAGTAATTTCATTTTATTTTTGGATGAAA
AAACATTTTAATTATTGGAAAAATCGAGGTTTTCTGCAAGTTGATGGATCATTTCCATTA
GGCTCACTTAGTGGTGTTGGAACAAAAATATGTTCGACTGAAAAATATGACTTGATTTAT
AAAGGTTTCAAGGGAAAAGCGTCGGTTGTTGGATTTTATAATTTTTTATCACCAGCAGTT
TTGCCAATTGAACCTGAATTGATTAAAAATATTTTGGTATTAAATTTTGCATCATTTCAT
GATCGTGGTCTTTATTATAATAAGAAAGATGATCCAATGAGTGCTAATTTAGTAGCTTTA
GAAGGTCAAGAATGGAAAGAACGTCGTACAAAAATCACCCCATTATTTTCATCAGGAAAG
ATTAAAATGATGTTTGAAATAGTCACTGAAATTGGTGATAAATTAGTAAATGCTATAAAA
AGAGAATTGAATGAGTCAACTGAACAAGATATGAGAGTTTGGGCACAAAAATATACAAAT
GATACAATTAGCAATATCGCATTTGGACTCTCTCTTTCTT

>g48.t2 Gene=g48 Length=193
MGFVLTLIIILVISFYFWMKKHFNYWKNRGFLQVDGSFPLGSLSGVGTKICSTEKYDLIY
KGFKGKASVVGFYNFLSPAVLPIEPELIKNILVLNFASFHDRGLYYNKKDDPMSANLVAL
EGQEWKERRTKITPLFSSGKIKMMFEIVTEIGDKLVNAIKRELNESTEQDMRVWAQKYTN
DTISNIAFGLSLS

Protein features from InterProScan

Transcript Database ID Name Start End E.value
8 g48.t2 Gene3D G3DSA:1.10.630.10 Cytochrome p450 14 193 1.1E-32
2 g48.t2 PANTHER PTHR24292 CYTOCHROME P450 4 191 8.8E-49
3 g48.t2 PANTHER PTHR24292:SF95 CYP6A16, ISOFORM B-RELATED 4 191 8.8E-49
5 g48.t2 PRINTS PR00464 Group II E-class P450 signature 122 142 3.5E-8
4 g48.t2 PRINTS PR00464 Group II E-class P450 signature 177 193 3.5E-8
1 g48.t2 Pfam PF00067 Cytochrome P450 68 192 1.0E-15
10 g48.t2 Phobius SIGNAL_PEPTIDE Signal peptide region 1 19 -
11 g48.t2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 2 -
12 g48.t2 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 3 14 -
13 g48.t2 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 15 19 -
9 g48.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 20 193 -
7 g48.t2 SUPERFAMILY SSF48264 Cytochrome P450 64 192 2.36E-23
6 g48.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 2 19 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0020037 heme binding MF
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen MF
GO:0005506 iron ion binding MF
GO:0004497 monooxygenase activity MF
GO:0055114 NA NA

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values