General information for g523.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Tachykinin-like peptides receptor 99D.
Parent gene
- The parent gene g523 is located on chr_3: 3880102..3884603 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g523 | g523.t1 | isoform | g523.t1 | 3880102 | 3884603 |
| chr_3 | g523 | g523.t1 | exon | g523.t1.exon1 | 3880102 | 3880331 |
| chr_3 | g523 | g523.t1 | cds | g523.t1.CDS1 | 3880102 | 3880331 |
| chr_3 | g523 | g523.t1 | exon | g523.t1.exon2 | 3882105 | 3882167 |
| chr_3 | g523 | g523.t1 | cds | g523.t1.CDS2 | 3882105 | 3882167 |
| chr_3 | g523 | g523.t1 | exon | g523.t1.exon3 | 3882329 | 3882465 |
| chr_3 | g523 | g523.t1 | cds | g523.t1.CDS3 | 3882329 | 3882465 |
| chr_3 | g523 | g523.t1 | exon | g523.t1.exon4 | 3884419 | 3884603 |
| chr_3 | g523 | g523.t1 | cds | g523.t1.CDS4 | 3884419 | 3884603 |
| chr_3 | g523 | g523.t1 | TSS | g523.t1 | NA | NA |
| chr_3 | g523 | g523.t1 | TTS | g523.t1 | NA | NA |
Sequences
>g523.t1 Gene=g523 Length=615
ATGATTATAGTTGTTCTGATATTTGCTGTATGTTGGCTGCCACAGAATGTTTACTTCATT
ATAACTTCTTACTATCCAAGTGTCACAACATATCCATACATCCAGGAGATTTATTTGGGT
ATTTATTTTCTTGCTATGAGCAACTCTATGTACAATCCAATCATCTACTGCATCTATTCG
GACAGATTCCGACGTGGTTTCAAACAAGTTTTCAGATGTTGTCCATTCGTTCATGTTGGA
CCGGAAGTGCTAACACGAAGGGAAGTGGTATCGAGGTATTCGTGTTCAGGCTCACCTGAT
CACCATCGAATTGTAAGAAACGATACAGAAAGGTCCTTTCTATACTCTTGCTCCGGGTCA
CCAAAAAGTCATCGCAAATCGCATGGTTCAATGCGGATACCATTGCAAATGTCAAAGTGT
AATCACGGCACAAATTCCACTTATCTCTCAATGAACTCCTTCAATAATAATAATCTAACA
ATGCAAAACGGTAATGAAGAAACAAATGTCACAGCGAGTGATAATCTTTTGTTACAAACA
ACAACGCCAGTGACAAATAAATGGACAACAACAAGAAATTTAAATGGAAATAGTCAACGA
ACATCATTGTCCTGA
>g523.t1 Gene=g523 Length=204
MIIVVLIFAVCWLPQNVYFIITSYYPSVTTYPYIQEIYLGIYFLAMSNSMYNPIIYCIYS
DRFRRGFKQVFRCCPFVHVGPEVLTRREVVSRYSCSGSPDHHRIVRNDTERSFLYSCSGS
PKSHRKSHGSMRIPLQMSKCNHGTNSTYLSMNSFNNNNLTMQNGNEETNVTASDNLLLQT
TTPVTNKWTTTRNLNGNSQRTSLS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g523.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 1 | 105 | 2.5E-28 |
| 2 | g523.t1 | PANTHER | PTHR24238 | G-PROTEIN COUPLED RECEPTOR | 1 | 132 | 9.0E-50 |
| 3 | g523.t1 | PANTHER | PTHR24238:SF31 | TACHYKININ-LIKE PEPTIDES RECEPTOR 99D | 1 | 132 | 9.0E-50 |
| 5 | g523.t1 | PRINTS | PR00244 | Neurokinin receptor signature | 31 | 42 | 3.3E-7 |
| 4 | g523.t1 | PRINTS | PR00244 | Neurokinin receptor signature | 57 | 75 | 3.3E-7 |
| 1 | g523.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 1 | 56 | 3.8E-8 |
| 10 | g523.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 19 | - |
| 11 | g523.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 1 | - |
| 12 | g523.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 2 | 13 | - |
| 14 | g523.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 14 | 19 | - |
| 9 | g523.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 20 | 37 | - |
| 13 | g523.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 38 | 59 | - |
| 8 | g523.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 60 | 204 | - |
| 17 | g523.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 1 | 56 | 14.373 |
| 6 | g523.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 1 | 86 | 1.74E-19 |
| 16 | g523.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 2 | 24 | - |
| 15 | g523.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 37 | 59 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g523/g523.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g523.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004995 | tachykinin receptor activity | MF |
| GO:0005886 | plasma membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K04224 (tachykinin receptor 3)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
