General information for g5311.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Adenosine receptor A2a.
Parent gene
- The parent gene g5311 is located on chr_2: 8659119..8659744 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5311 | g5311.t1 | TSS | g5311.t1 | 8658338 | 8658338 |
| chr_2 | g5311 | g5311.t1 | isoform | g5311.t1 | 8658383 | 8659744 |
| chr_2 | g5311 | g5311.t1 | exon | g5311.t1.exon1 | 8658383 | 8658589 |
| chr_2 | g5311 | g5311.t1 | cds | g5311.t1.CDS1 | 8658383 | 8658589 |
| chr_2 | g5311 | g5311.t1 | exon | g5311.t1.exon2 | 8658651 | 8658767 |
| chr_2 | g5311 | g5311.t1 | cds | g5311.t1.CDS2 | 8658651 | 8658767 |
| chr_2 | g5311 | g5311.t1 | exon | g5311.t1.exon3 | 8658832 | 8658886 |
| chr_2 | g5311 | g5311.t1 | cds | g5311.t1.CDS3 | 8658832 | 8658886 |
| chr_2 | g5311 | g5311.t1 | exon | g5311.t1.exon4 | 8658944 | 8659128 |
| chr_2 | g5311 | g5311.t1 | cds | g5311.t1.CDS4 | 8658944 | 8659128 |
| chr_2 | g5311 | g5311.t1 | exon | g5311.t1.exon5 | 8659187 | 8659297 |
| chr_2 | g5311 | g5311.t1 | cds | g5311.t1.CDS5 | 8659187 | 8659297 |
| chr_2 | g5311 | g5311.t1 | exon | g5311.t1.exon6 | 8659406 | 8659744 |
| chr_2 | g5311 | g5311.t1 | cds | g5311.t1.CDS6 | 8659406 | 8659744 |
| chr_2 | g5311 | g5311.t1 | TTS | g5311.t1 | 8659818 | 8659818 |
Sequences
>g5311.t1 Gene=g5311 Length=1014
ATGTCGAATTTTAAAATTAAAGAAGAAAATTTAATTTACACAATAGTTGATATTGTATTT
GCATTGTTCGCAATCATTGCAAATAGTTTTGTGATTGCTGCATTTTGTTTGGAACGAAAA
TTAAGACGAAGAATTCATTATTTTTTACTTTCATTGTCAATAATTGATCTTCTTATTGGT
TTTTTGGCTATACCTGCTACAATTATTCTTGATGCTGACTTTATTCATGAAAAATATCCA
TGTTTAGCTTTATTTACATGTTTCATCACAATTTTCACCATATCAAAATGGAACATGGTT
GGGATTGTTTGTAATTGCTATTGGGCGATTCTTCATCCAATTCATTATCATCGTTATAAA
CACAAACTTCCTGAAAAATGGTTCATTGCACTCACATGGATAATTGGAATTATTATTGGA
ATTTTACCAATAGCAGGATGGAATAATTATATAAATCAATGCTTTTATGAAAGTGTGATT
GATAAAAATTACAATTTCTTCTTTTACACTGTTGACTTTCTTGTCTTAGTTGCATATTGT
TTGATAATTTTTCAAACTCTAAAGAAAACTAATAATAATGACACAAATGTAGGAACCTCA
AATACAAATTTATATGATATCACAATTGCCAAAAAACTTATGACGATCGTAATAATTTTT
TTGCTTTGTTGGATTCCTCTTCATATCATCAACATTACTACATCATTAAACCCAAACATT
GTCATTGAACATTATGTGATACAACTGGCTATCCTTGCTCATCATTTTTCAGTTGCATTA
AATCCAGTTCTCTATGCATTCCGAATTGAAGAAGTTCGTGAAACCGTTTTGAAAATTTTC
AAGAAAAAAAGAGGAAAATTTTATTCAATTCCACAAAATGAATCCACAATGCAAAGCCAA
AAGTTGGACAGAAAAGATATTTTAGGAAAATTTCAGTCCGATTGGGAATCAGTTCCAAAA
CCTTCTGATGTTCTTTCTTCTGAATTATCTGAATCTGGGAGAATGCCAATTTGA
>g5311.t1 Gene=g5311 Length=337
MSNFKIKEENLIYTIVDIVFALFAIIANSFVIAAFCLERKLRRRIHYFLLSLSIIDLLIG
FLAIPATIILDADFIHEKYPCLALFTCFITIFTISKWNMVGIVCNCYWAILHPIHYHRYK
HKLPEKWFIALTWIIGIIIGILPIAGWNNYINQCFYESVIDKNYNFFFYTVDFLVLVAYC
LIIFQTLKKTNNNDTNVGTSNTNLYDITIAKKLMTIVIIFLLCWIPLHIINITTSLNPNI
VIEHYVIQLAILAHHFSVALNPVLYAFRIEEVRETVLKIFKKKRGKFYSIPQNESTMQSQ
KLDRKDILGKFQSDWESVPKPSDVLSSELSESGRMPI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g5311.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 2 | 289 | 1.0E-50 |
| 34 | g5311.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 317 | 337 | - |
| 2 | g5311.t1 | PANTHER | PTHR24246:SF23 | SI:CH211-233F11.5 | 7 | 306 | 1.5E-37 |
| 3 | g5311.t1 | PANTHER | PTHR24246 | OLFACTORY RECEPTOR AND ADENOSINE RECEPTOR | 7 | 306 | 1.5E-37 |
| 4 | g5311.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 12 | 36 | 1.2E-18 |
| 6 | g5311.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 45 | 66 | 1.2E-18 |
| 8 | g5311.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 124 | 145 | 1.2E-18 |
| 7 | g5311.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 209 | 233 | 1.2E-18 |
| 5 | g5311.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 247 | 273 | 1.2E-18 |
| 1 | g5311.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 28 | 265 | 1.0E-29 |
| 15 | g5311.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 23 | g5311.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 35 | - |
| 13 | g5311.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 36 | 46 | - |
| 20 | g5311.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 47 | 70 | - |
| 17 | g5311.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 71 | 81 | - |
| 25 | g5311.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 82 | 107 | - |
| 12 | g5311.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 108 | 126 | - |
| 24 | g5311.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 127 | 146 | - |
| 18 | g5311.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 147 | 165 | - |
| 22 | g5311.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 166 | 184 | - |
| 14 | g5311.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 185 | 212 | - |
| 19 | g5311.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 213 | 233 | - |
| 16 | g5311.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 234 | 244 | - |
| 21 | g5311.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 245 | 267 | - |
| 11 | g5311.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 268 | 337 | - |
| 35 | g5311.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 27 | 265 | 27.232 |
| 33 | g5311.t1 | SMART | SM01381 | 7TM_GPCR_Srsx_2 | 21 | 280 | 0.0011 |
| 9 | g5311.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 9 | 295 | 1.28E-46 |
| 30 | g5311.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 35 | - |
| 27 | g5311.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 70 | - |
| 26 | g5311.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 85 | 107 | - |
| 31 | g5311.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 128 | 150 | - |
| 32 | g5311.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 165 | 187 | - |
| 28 | g5311.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 208 | 230 | - |
| 29 | g5311.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 245 | 267 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5311/g5311.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5311.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
