General information for g5501.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Glutathione S-transferase 1, isoform D.
Parent gene
- The parent gene g5501 is located on chr_2: 9921472..9922546 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5501 | g5501.t1 | TSS | g5501.t1 | 9921422 | 9921422 |
| chr_2 | g5501 | g5501.t1 | isoform | g5501.t1 | 9921472 | 9922546 |
| chr_2 | g5501 | g5501.t1 | exon | g5501.t1.exon1 | 9921472 | 9921810 |
| chr_2 | g5501 | g5501.t1 | cds | g5501.t1.CDS1 | 9921472 | 9921810 |
| chr_2 | g5501 | g5501.t1 | exon | g5501.t1.exon2 | 9922235 | 9922546 |
| chr_2 | g5501 | g5501.t1 | cds | g5501.t1.CDS2 | 9922235 | 9922546 |
| chr_2 | g5501 | g5501.t1 | TTS | g5501.t1 | 9922633 | 9922633 |
Sequences
>g5501.t1 Gene=g5501 Length=651
ATGGTTTTGAAATTGTATTTTTTAAGTGCGTCACCTCCAGCTCGTGCTGTGCTTCTTACA
TGTAGAAATTTAAAGTTGGATGTTGAATTAATAACAATCGATTTATTTAAAAGTGAACAT
TACAAACCTGATTTTCTAAAACTCAATCCAGCTCATCAAATACCTGTGCTTGTTGACAAT
GACTTTGTGTTAAGTGAATCTCGCGCAATAATGGGATATTTGGTCAATAAATATCAGCCA
GATAGTTCGCTTTATCCAACTGATGTTTACAAAAGAGCTTTGATTGATCAACGACTATAT
TTTGATGCACAAGTATTTGAAAGAAATGCTGCTGCAATTCGTCCAGCATTTCGGGAACCA
CCTGAAAAACCAACAAATGAAGCAAAATATTTTATTACAGACTATATGGAAATTTTGGAT
AAAATATTAAGTGACAGTGTGTGGTTTGCTGGAAATTCGATCACAATTGCTGACTATACT
ATTTTAGTAAATATTTCTCAAATTAAAGCTTGCGGTTTTGACATCTCGAAATATACAAAT
TTGGTTCGATGGTTTGAAAAATGTAAATCAATTGAAGGTTTCGATGAGAATAATGAAGCA
GCTTTAAAACTAGGTGAATTATTCAAAAGTCGAGTTGGAAATGTGTTTTAA
>g5501.t1 Gene=g5501 Length=216
MVLKLYFLSASPPARAVLLTCRNLKLDVELITIDLFKSEHYKPDFLKLNPAHQIPVLVDN
DFVLSESRAIMGYLVNKYQPDSSLYPTDVYKRALIDQRLYFDAQVFERNAAAIRPAFREP
PEKPTNEAKYFITDYMEILDKILSDSVWFAGNSITIADYTILVNISQIKACGFDISKYTN
LVRWFEKCKSIEGFDENNEAALKLGELFKSRVGNVF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 14 | g5501.t1 | CDD | cd03045 | GST_N_Delta_Epsilon | 3 | 76 | 1.08126E-34 |
| 13 | g5501.t1 | CDD | cd03177 | GST_C_Delta_Epsilon | 91 | 203 | 2.00855E-28 |
| 7 | g5501.t1 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 1 | 80 | 2.0E-27 |
| 6 | g5501.t1 | Gene3D | G3DSA:1.20.1050.10 | - | 81 | 214 | 8.1E-35 |
| 3 | g5501.t1 | PANTHER | PTHR43969 | GLUTATHIONE S TRANSFERASE D10, ISOFORM A-RELATED | 3 | 203 | 4.9E-63 |
| 2 | g5501.t1 | Pfam | PF02798 | Glutathione S-transferase, N-terminal domain | 1 | 75 | 1.1E-14 |
| 1 | g5501.t1 | Pfam | PF00043 | Glutathione S-transferase, C-terminal domain | 119 | 189 | 1.5E-7 |
| 9 | g5501.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 16 | - |
| 10 | g5501.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 1 | - |
| 11 | g5501.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 2 | 10 | - |
| 12 | g5501.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 11 | 16 | - |
| 8 | g5501.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 17 | 216 | - |
| 16 | g5501.t1 | ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 1 | 82 | 21.832 |
| 15 | g5501.t1 | ProSiteProfiles | PS50405 | Soluble glutathione S-transferase C-terminal domain profile. | 88 | 212 | 18.736 |
| 17 | g5501.t1 | SFLD | SFLDG01153 | Main.4: Theta-like | 2 | 211 | 0.0 |
| 18 | g5501.t1 | SFLD | SFLDS00019 | Glutathione Transferase (cytosolic) | 2 | 211 | 0.0 |
| 4 | g5501.t1 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 1 | 86 | 3.45E-25 |
| 5 | g5501.t1 | SUPERFAMILY | SSF47616 | GST C-terminal domain-like | 80 | 201 | 8.63E-26 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5501/g5501.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5501.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006749 | glutathione metabolic process | BP |
| GO:0005515 | protein binding | MF |
KEGG
Orthology
- This transcript has been annotated with K00799 (glutathione S-transferase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed