Chromosome | Gene | Transcript | Category | ID | Start | End |
---|---|---|---|---|---|---|
chr_2 | g6244 | g6244.t3 | TSS | g6244.t3 | 15598286 | 15598286 |
chr_2 | g6244 | g6244.t3 | isoform | g6244.t3 | 15598348 | 15599048 |
chr_2 | g6244 | g6244.t3 | exon | g6244.t3.exon1 | 15598348 | 15598372 |
chr_2 | g6244 | g6244.t3 | cds | g6244.t3.CDS1 | 15598348 | 15598372 |
chr_2 | g6244 | g6244.t3 | exon | g6244.t3.exon2 | 15598441 | 15598898 |
chr_2 | g6244 | g6244.t3 | cds | g6244.t3.CDS2 | 15598441 | 15598898 |
chr_2 | g6244 | g6244.t3 | exon | g6244.t3.exon3 | 15598981 | 15599048 |
chr_2 | g6244 | g6244.t3 | cds | g6244.t3.CDS3 | 15598981 | 15599019 |
chr_2 | g6244 | g6244.t3 | TTS | g6244.t3 | 15599086 | 15599086 |
>g6244.t3 Gene=g6244 Length=551
ATGTGTGATTTATATTATACACCCGCGTCTGGACCTTGTAGAGTGGTTCAGATGGTAGCA
CATGCATTGAAAGTGAAACTCAATTTGAAGCCATTAAACCTTCAACAAAAAGAACATCTT
GCACCAGAATTTTTAAAACTCAATCCACAACATACAGTTCCGACTCTTGTCGACAATAAT
TTTGCACTTTGGGAATCACGTCCGATTGCAATTTATTTGGTGGAAAAATACGCAAAAGAT
GATTCACTTTATCCGAAGAATGCAAAACAACGAGCTGTGGTGAATCAACAATTATATTTT
GACATGGGAACACTTTCAAAACGAATGTATGATTTTTTCTATCCACAATTAATGCAAAAT
GCTGAGGCTGATCCAAAAAAGTTCAAAGAACTTGAAGAAGCTGTTGAATTTTTGGAAACA
AGTTTAAGCAAATCAACATATGCAGCGGGTGAAAAGTTAACAATTGCTGATTTTGCGTTA
GCAATGAATTACCTGGTTGGGAAATTAATGAAGAAGGATTAAATGTGATGAGACAATATA
TGAAGAAATAA
>g6244.t3 Gene=g6244 Length=173
MCDLYYTPASGPCRVVQMVAHALKVKLNLKPLNLQQKEHLAPEFLKLNPQHTVPTLVDNN
FALWESRPIAIYLVEKYAKDDSLYPKNAKQRAVVNQQLYFDMGTLSKRMYDFFYPQLMQN
AEADPKKFKELEEAVEFLETSLSKSTYAAGEKLTIADFALAMNYLVGKLMKKD
Transcript | Database | ID | Name | Start | End | E.value | |
---|---|---|---|---|---|---|---|
12 | g6244.t3 | CDD | cd03045 | GST_N_Delta_Epsilon | 3 | 75 | 0.000 |
11 | g6244.t3 | CDD | cd03177 | GST_C_Delta_Epsilon | 89 | 160 | 0.000 |
8 | g6244.t3 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 2 | 78 | 0.000 |
7 | g6244.t3 | Gene3D | G3DSA:1.20.1050.10 | - | 79 | 173 | 0.000 |
3 | g6244.t3 | PANTHER | PTHR43969:SF9 | GLUTATHIONE S TRANSFERASE D10, ISOFORM A-RELATED | 2 | 163 | 0.000 |
4 | g6244.t3 | PANTHER | PTHR43969 | GLUTATHIONE S TRANSFERASE D10, ISOFORM A-RELATED | 2 | 163 | 0.000 |
2 | g6244.t3 | Pfam | PF13417 | Glutathione S-transferase, N-terminal domain | 4 | 78 | 0.000 |
1 | g6244.t3 | Pfam | PF00043 | Glutathione S-transferase, C-terminal domain | 118 | 161 | 0.000 |
10 | g6244.t3 | ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 1 | 81 | 19.996 |
9 | g6244.t3 | ProSiteProfiles | PS50405 | Soluble glutathione S-transferase C-terminal domain profile. | 87 | 173 | 15.099 |
13 | g6244.t3 | SFLD | SFLDG00358 | Main (cytGST) | 3 | 164 | 0.000 |
14 | g6244.t3 | SFLD | SFLDG01153 | Main.4: Theta-like | 3 | 164 | 0.000 |
5 | g6244.t3 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 2 | 86 | 0.000 |
6 | g6244.t3 | SUPERFAMILY | SSF47616 | GST C-terminal domain-like | 79 | 168 | 0.000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
GOID | TERM | ONTOLOGY |
---|---|---|
GO:0006749 | glutathione metabolic process | BP |
GO:0005515 | protein binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed