General information for g6640.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Acylphosphatase-2.
Parent gene
- The parent gene g6640 is located on chr_2: 17908954..17909505 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6640 | g6640.t1 | TSS | g6640.t1 | 17908679 | 17908679 |
| chr_2 | g6640 | g6640.t1 | isoform | g6640.t1 | 17908954 | 17909505 |
| chr_2 | g6640 | g6640.t1 | exon | g6640.t1.exon1 | 17908954 | 17909011 |
| chr_2 | g6640 | g6640.t1 | cds | g6640.t1.CDS1 | 17908954 | 17909011 |
| chr_2 | g6640 | g6640.t1 | exon | g6640.t1.exon2 | 17909063 | 17909189 |
| chr_2 | g6640 | g6640.t1 | cds | g6640.t1.CDS2 | 17909063 | 17909189 |
| chr_2 | g6640 | g6640.t1 | exon | g6640.t1.exon3 | 17909391 | 17909505 |
| chr_2 | g6640 | g6640.t1 | cds | g6640.t1.CDS3 | 17909391 | 17909505 |
| chr_2 | g6640 | g6640.t1 | TTS | g6640.t1 | 17909647 | 17909647 |
Sequences
>g6640.t1 Gene=g6640 Length=300
ATGGACGATTCAAATTTACTTGTACAAGTTAATTTTGAAGTATTTGGTCATGTTCAAGGA
GTGGGATTTACAAAATATTGTAAAGATAACTGCCTGAATGCTGGTATACGTGGTTGGGTC
AAGAATAGTAAAAAAGGAACAATTGTTGGAAAAATGCAAGGACTTAAACCAGAAATTGAC
AAAATGGTGGAATGGCTTAGACATATGGGAGCACCGGGTTCAAAAATTGAACGATGTGAA
TTTGAAAACTGGAACACAATCAACAGATTTGATTACAAAGATTTTGAAATTAGGTTTTAA
>g6640.t1 Gene=g6640 Length=99
MDDSNLLVQVNFEVFGHVQGVGFTKYCKDNCLNAGIRGWVKNSKKGTIVGKMQGLKPEID
KMVEWLRHMGAPGSKIERCEFENWNTINRFDYKDFEIRF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g6640.t1 | Gene3D | G3DSA:3.30.70.100 | - | 2 | 99 | 0.000 |
| 2 | g6640.t1 | PANTHER | PTHR10029:SF10 | GEO08407P1 | 4 | 99 | 0.000 |
| 3 | g6640.t1 | PANTHER | PTHR10029 | ACYLPHOSPHATASE | 4 | 99 | 0.000 |
| 6 | g6640.t1 | PRINTS | PR00112 | Acylphosphatase signature | 9 | 24 | 0.000 |
| 5 | g6640.t1 | PRINTS | PR00112 | Acylphosphatase signature | 30 | 55 | 0.000 |
| 4 | g6640.t1 | PRINTS | PR00112 | Acylphosphatase signature | 65 | 85 | 0.000 |
| 1 | g6640.t1 | Pfam | PF00708 | Acylphosphatase | 11 | 97 | 0.000 |
| 9 | g6640.t1 | ProSiteProfiles | PS51160 | Acylphosphatase-like domain profile. | 9 | 99 | 26.117 |
| 7 | g6640.t1 | SUPERFAMILY | SSF54975 | Acylphosphatase/BLUF domain-like | 8 | 98 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003998 | acylphosphatase activity | MF |
KEGG
Orthology
- This transcript has been annotated with K01512 (acylphosphatase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed