General information for g7294.t77
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Catalase.
Parent gene
- The parent gene g7294 is located on chr_2: 22742132..22746850 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7294 | g7294.t77 | TSS | g7294.t77 | 22738599 | 22738599 |
| chr_2 | g7294 | g7294.t77 | isoform | g7294.t77 | 22738642 | 22741754 |
| chr_2 | g7294 | g7294.t77 | exon | g7294.t77.exon1 | 22738642 | 22738668 |
| chr_2 | g7294 | g7294.t77 | exon | g7294.t77.exon2 | 22738717 | 22738820 |
| chr_2 | g7294 | g7294.t77 | cds | g7294.t77.CDS1 | 22738773 | 22738820 |
| chr_2 | g7294 | g7294.t77 | exon | g7294.t77.exon3 | 22741499 | 22741754 |
| chr_2 | g7294 | g7294.t77 | cds | g7294.t77.CDS2 | 22741499 | 22741753 |
| chr_2 | g7294 | g7294.t77 | TTS | g7294.t77 | NA | NA |
Sequences
>g7294.t77 Gene=g7294 Length=387
GGAATAACATTTTTTCAGCTGATAATTTCTTTTTTATTTCAGTGTGTGTGATTTGAAGTG
AACAAAAGTGAAAAATAACAAAAATGTCGGCTTCTCAAAATCAACTTAGTGACTTTAAAA
AATCACTTAAGAATGGCCCAGCTGTTGCTACTGTTGGAAATGGTGCACCAATCGGTGTTA
AGACAGCAACACAAACTGTTGGACCACGTGGCCCAGCTCTCTTGCAAGATGCAAATTACA
TCGATGAGATGAGCCACTTTGATCGTGAAAGAGTTCCAGAACGTGTTGTCCATGCCAAAG
GTGCTGGTGCTTTTGGATATTTTGAAGTTACTCATGATATTACAAAATACTGTGCTGCAA
AAGTCTTTGAAAAAGTTGGAAAACGCA
>g7294.t77 Gene=g7294 Length=101
MSASQNQLSDFKKSLKNGPAVATVGNGAPIGVKTATQTVGPRGPALLQDANYIDEMSHFD
RERVPERVVHAKGAGAFGYFEVTHDITKYCAAKVFEKVGKR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g7294.t77 | Gene3D | G3DSA:1.10.8.1230 | - | 2 | 63 | 1.6E-23 |
| 6 | g7294.t77 | Gene3D | G3DSA:2.40.180.20 | - | 64 | 101 | 6.8E-16 |
| 2 | g7294.t77 | PANTHER | PTHR11465:SF25 | PEROXISOMAL CATALASE 1 | 3 | 100 | 8.4E-36 |
| 3 | g7294.t77 | PANTHER | PTHR11465 | CATALASE | 3 | 100 | 8.4E-36 |
| 1 | g7294.t77 | Pfam | PF00199 | Catalase | 24 | 101 | 9.8E-31 |
| 5 | g7294.t77 | ProSitePatterns | PS00438 | Catalase proximal active site signature. | 59 | 75 | - |
| 8 | g7294.t77 | ProSiteProfiles | PS51402 | catalase family profile. | 19 | 101 | 14.911 |
| 4 | g7294.t77 | SUPERFAMILY | SSF56634 | Heme-dependent catalase-like | 15 | 101 | 3.66E-33 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006979 | response to oxidative stress | BP |
| GO:0020037 | heme binding | MF |
| GO:0004096 | catalase activity | MF |
| GO:0055114 | NA | NA |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
