General information for g8049.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as ADP-ribosylation factor 6.
Parent gene
- The parent gene g8049 is located on chr_2: 28213623..28218219 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8049 | g8049.t1 | TTS | g8049.t1 | 28213121 | 28213121 |
| chr_2 | g8049 | g8049.t1 | isoform | g8049.t1 | 28213623 | 28214386 |
| chr_2 | g8049 | g8049.t1 | exon | g8049.t1.exon1 | 28213623 | 28213765 |
| chr_2 | g8049 | g8049.t1 | cds | g8049.t1.CDS1 | 28213623 | 28213765 |
| chr_2 | g8049 | g8049.t1 | exon | g8049.t1.exon2 | 28213855 | 28214106 |
| chr_2 | g8049 | g8049.t1 | cds | g8049.t1.CDS2 | 28213855 | 28214106 |
| chr_2 | g8049 | g8049.t1 | exon | g8049.t1.exon3 | 28214180 | 28214230 |
| chr_2 | g8049 | g8049.t1 | cds | g8049.t1.CDS3 | 28214180 | 28214230 |
| chr_2 | g8049 | g8049.t1 | exon | g8049.t1.exon4 | 28214305 | 28214386 |
| chr_2 | g8049 | g8049.t1 | cds | g8049.t1.CDS4 | 28214305 | 28214386 |
| chr_2 | g8049 | g8049.t1 | TSS | g8049.t1 | NA | NA |
Sequences
>g8049.t1 Gene=g8049 Length=528
ATGGGAAAGTTACTATCCAAAATATTTGGCAATAAAGAAATGAGAATACTAATGTTGGGG
CTCGATGCCGCTGGTAAAACAACAATTTTGTATAAATTAAAATTAGGGCAATCAGTTACT
ACTATTCCAACAGTTGGATTCAACGTTGAGACAGTCACATATAAAAATGTTAAGTTTAAT
GTGTGGGATGTAGGAGGTCAAGATAAAATTCGTCCTTTATGGCGACATTACTATACAGGA
ACTCAAGGACTCATATTTGTGGTAGATTGTGCGGATAGAGATCGTATTGATGAAGCACGT
CAGGAGCTACATCGAATTATAAATGATAGAGAAATGCGTGATGCAATTATTTTAATATTT
GCCAACAAACAAGATTTACCTGATGCAATGAAGCCCCACGAGATACAAGAAAAACTTGGT
CTTACACGTATTCGTGATCGAAATTGGTATGTGCAGCCTTCATGTGCGACATCCGGTGAT
GGTTTATACGAAGGACTCACATGGTTGACTTCAAATCACAAATTATGA
>g8049.t1 Gene=g8049 Length=175
MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNHKL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g8049.t1 | CDD | cd04149 | Arf6 | 5 | 172 | 0.00000 |
| 9 | g8049.t1 | Gene3D | G3DSA:3.40.50.300 | - | 14 | 172 | 0.00000 |
| 2 | g8049.t1 | PANTHER | PTHR11711 | ADP RIBOSYLATION FACTOR-RELATED | 1 | 174 | 0.00000 |
| 3 | g8049.t1 | PANTHER | PTHR11711:SF394 | ADP-RIBOSYLATION FACTOR 6 | 1 | 174 | 0.00000 |
| 4 | g8049.t1 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 15 | 38 | 0.00000 |
| 6 | g8049.t1 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 43 | 67 | 0.00000 |
| 5 | g8049.t1 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 70 | 95 | 0.00000 |
| 7 | g8049.t1 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 115 | 136 | 0.00000 |
| 1 | g8049.t1 | Pfam | PF00025 | ADP-ribosylation factor family | 2 | 172 | 0.00000 |
| 15 | g8049.t1 | ProSiteProfiles | PS51417 | small GTPase Arf family profile. | 7 | 175 | 25.03000 |
| 11 | g8049.t1 | SMART | SM00177 | arf_sub_2 | 1 | 174 | 0.00000 |
| 13 | g8049.t1 | SMART | SM00178 | sar_sub_1 | 1 | 173 | 0.00000 |
| 12 | g8049.t1 | SMART | SM00175 | rab_sub_5 | 14 | 147 | 0.00049 |
| 8 | g8049.t1 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 10 | 171 | 0.00000 |
| 14 | g8049.t1 | TIGRFAM | TIGR00231 | small_GTP: small GTP-binding protein domain | 12 | 139 | 0.00000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005525 | GTP binding | MF |
| GO:0003924 | GTPase activity | MF |
KEGG
Orthology
- This transcript has been annotated with K07941 (ADP-ribosylation factor 6)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
